Group RoyalRoadL

Group Aliases

  • RoyalRoadL

Series

_
---
⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢ ⁢ ⁢ ⁢ ⁢⁢⁢⁢⁢⁢⁢⁢⁢⁢
0-Day
+1
1000-Hit KO
1000 Lives Relived
100 Luck and the Dragon Tamer Skill!
100 Words
12345
12 Zodiac!!
13.Ai
13 Clans of Gods: Book One [The God of Void]
13 Seconds
13th Soul- Book 1 The God Slayer
1) DECK: Annoying Dreams
1 Vs Tthe World
1x1I5
200X300
2040: Reconnection
2100
21st Century Lads
2278
24
243 Wanderers
24 The Conspiracy
2.5 D adventure
299 441 Yen
2 Worlds
3.0.1
3 Bastards and a Red Slipper Demon Queen
3D/2D: I Got Sent to a Fantasy World and Turned into an Anime Character?!
46 Year Old Syndrome
49 And One Hero.
5 Dragon Emperor
72 Hours
777
7 Dragons and Princess
8th Deadly Sin
9001: A Dungeon Ship Odyssey
9001: The resurrection of the Dominion
99 Dungeons: The Beast Lord
9 Circles of Hell
9 Lives
A 3% Chance for Glory
A Ai`S Adventure In A Different World In Space
A android,a ghost ,a immortal,a necromancer and a council in a bar
A bad deal.
A Bag Of Bones
Abandon all hope by Darkmatter
[Abandoned]
Abandoned Card System
***ABANDONED***It Was the Best of Slimes, It Was the Worst of Slimes
Abandoned: The Story About Ryu The Banished God
A Battle of Eyes Against the Gods
Ability
Ability to make a kingdom? Let's make a fast food restaurant!
A Billion Players
Ab Initio
A Bizarre World.
A Black Man Reborn in Jiang Hu!
A Blade's Shadow
A Blazing Journey: A New Beginning
A blend of everything
A Blighted World
A Blond Ray of Sunshine
Abnormal
Abnormal Boy Enters A New World
Abominable King
Abomination
A book fanatic's Journey through a Fantasy World
A bored boy looking for reason
A Bored Immortal's Adventure with Reincarnation
A Bored Passerby With Some Cheats
A Bored Soul
A bored story (Hiatus)
A "boring" Game.
Above All
Above Heavens I Stand
Above the Heavens
A Boy's Wish
A brave new, Scary world
A Brave New World
A Breath of Fresh Air
A Broken Doll and her lost Soul
A Broken Kingdom
A Broken World
Absalom's Fate (The Everlands Book 1)
Abscondere
Absolute Knowledge
Absolute Power of the Imagination
Absolution
Absorbed
Absurd Mage in Another World
Abyssal Fortress girl in another world
Abyssal King
Abyss Core
Abyssmal Downpour
Abyss: Phantom Cosmos
Abyss System
Abyss "tomb of the gods"
Academe's Blood
Academy of Heroes (The Murder of Innocence)
Academy Saint
Acadia: A LitRPG Adventure
Acaslaria
A Castle in a Teacup
A Cat's Purpose
Accidental dungeon
Accidental Love Destined Betrayal
Accidentally Blessed by a Goddess Before Reincarnating
Accidental Merlin
Accidental Orc
Accidental Orc (A LitRPG Story)
Accidental Summon
Accidental Time God
Accidential dungeon
Acclimation
Accused Hero
A Celestial's Wrath
A Century Later
Ace of all Trades
Ace of Demons
Ace of the Unknown
A chance
A Chance Again
A Change In The Same World
A Cheap, OP Brawler
A Cheat Cultivation Level
A Chuunibyou's Life in Another World!
A Civil Minotaur In An Uncivilized World
A Cliché Reincarnation
A Clone of Arth
A Collection Of Ideas. True's Oneshots.
A Collection of Tales
A Collection of the CRAZY STORYTELLER
A Collection of Thoughts
A Compendium of Useless Powers
A complicated man with a simple dream
A Conquest of the Stars: The Heart's Anguish
A Contest of Lords
Acousat
Across a different world
Across the Realms
Action, Adventure, Videogame
A Cup of Moondust
A curious cat's life in a new world
A Curious World
A Cursed Life.
Adamant Doom
Adamantine Dragon in the Crystal World
Adamantine Heart
Adam's coin
Adam: The Archer
A Dance of Poison and Curses
A Dark and Dangerous Place
A Darkened Realm
A Dark Prophecy of the Last Age: From One War Torn World to Another
A Dark Road
A Day With The Cross Dimensional Traveling Truck Driver
Addorn: "The Freed of The Void"
A Demon Between Worlds
A Demon Lord NEED HELP!
A Demon lord's dilemma
A Demon Lord's Virtual [Magic Life]
A Demon, Probably
A Demons Evolution
A Demons Evolution (Hiatus)
A Demon's Gift
A Demon Within
A Deranged World
A Descent into Decay
A Devil's Child
A Different Kind Of Hero
A Different kind of Hero (Marvel)
A Different Kind of Hero (Will Be Revised)
A Disciple from Beginning, A Master to End
A Dissonance in Harmony
A Diver's Tale
A dragon familar
A Dragon Gnawing Its Tail
A Dragon In human Skin
A Dragonoid's Tale
A Dragon's Curiosity
A Dragon's Dungeon
A Dragon With Fur
A D-rank Adventurer's Bizzare Reincarnation
A Dream
A Dream to the Summit
A Dryad isn't just firewood
A Dryflame Child's Life
ADT - Another Dimension Travel
A Dulled Blade
A Dumb Girl in a Cultivation World
A Dungeon Core
A dungeon core story: Magic with a hint of Science
A Dungeon in Space
A Dungeon of Fate and Fae
A Dungeon Of Fire And Death ( english ) Eine MI des Feuers und Todes ( german )
A Dungeon's Journey
A Dungeon's life
A Dungeons Quest
A Dungeon Tested
Advent
Advent of an Assassin
Advent of the Apostles
Advent: Red Mage
Adventured
Adventure From A Bard's Perspective
Adventure In A Foreign World - Legacy of The Chosen One
Adventure of Adventures
Adventure of a system supported gamer
Adventure of Chance
Adventure of Lara
Adventure of Luke
Adventure of The Eternal Brothers
Adventure Online
Adventure Quest: Guardians of The Night Sky
Adventurer Academy: Greyblood
Adventurer Academy: Greyblood (A LitRPG Series)
Adventurer Hearth's Guide to Monster Taming
Adventures in amnesia
Adventures in Atalok
Adventures in Mim
Adventures in Planus
Adventures in the Land of Amerikan
Adventures in the Pirate Continent
Adventures in Wonderland
Adventure? Slime? Slimeventure? Yeah, something like that.
Adventures of a Fake Monk
Adventures of A God!
Adventures of Alex Blackwell
Adventures of an avid gamer
Adventures of an Old Dreamer
Adventures of a young Zuma
Adventures of Faven
Adventures of Kaelem Solich
Adventures of Lord Genesis
Adventures of one dude with an afro
Adventures of Ragnos
Adventures of the Blasted Marksman [Rewrite]
Adventures of the First Being
Adventures of the moon
Adventures Of Truck-san
Adventures on Terra: Beginning
Adventures With a Reincarnated Bush
Adventure to the Stars
Adventurous Madman
Advice for Authors
*A Dwarf's Story*
A Dying World
[AEAC] Amazing and exciting adventure of Clavius
--Aegis--
Aegis Of The Gods
Aelin (title may change)
Aenthar
AEO Alt Earth Online
Aeon Chronicles: The Frozen Calamity
Aeromancer
Aeroth: The Arrival of the Beasts
Aesthetic of a Female Rogue
Aestral Online
Aeterna
Aeterna Saga, Volume 1: Walking With Giants
Aether
Aether Dragon
Aether Gate Online: Slayer (A LitRPG Saga)
Aethernea
Ætla Verǫld
Aevitas — I am not an NPC [R]
A fairy tale for the nephilim
A Fantasy in Time
A Fantasy of Everglow
A Farmer's Strength
A Fate Set in Stone (On Hold)
A Female Rogue's Adventure Through Two Worlds
A Female's Take on The World of Cultivation
A festering world
A Fiery VRMMORPG adventure
A Fool fooling around in another world
*A Fool's Errand*
A Forbidden Contract
A Forced Hero
A Forest Dungeon
A Forgotten Grimoire
A forgotten ruler
A Forgotten Soul
A Forgotten Specter
A Fox at Heart
A Fox in the Woods
A Fox's System
A Fragmented Mind
A Friendly Shadow
After Dawn
Afterdeath
After Death
After death?
After Eons
After I Lost to the Demon King
After Kreation: A Widower's Tale
Afterlife
After Life
After Life?
After-Life
Afterlife Hospital
Afterlife - Next World's Auction House
Afterlife Online
Afterlife Online: Reboot
Aftermath : Creul Confine
After Megiddo: The Book of Gideon
After the Fall. (Book 1 of the Shardfall Saga)
After the Game Over
After The Mountains Are Flattened
After the universe exploded, I became a Dungeon Master.
AfterWorld
After Worlds End
A futurist leader inside a fantasy world
Again
Again?!!
Again [On hold]
Against all the Odds(hiatus)
Against My Fate
Against The Elements
Against the heavens.
Against the Nine Great Heavens
Against the Sky
Against the World. Chronicles of melancholy
A Galactic Dictator's Adventures into a Magical World!
A Game For Monsters
A Game Of Chess
A Game of Dancing Pieces
A Game of Hedrons
A Game of Life
A Game of Unknown Origins
A Gamer But I Also A Realist That Do Not Believe Anything That Not Disprove
Agartha (hiatus)
Ageless Aneurin
A Gem To Be Remembered [bl]
A generic love story
A Gentleman's Curse
Agent of the Alternates
Agent of the Realm?
Agents of the Lord
Age Of Adventure
Age of Aggression
Age of Champions
Age of Change
Age of Destruction *dropped*
Age of Gods
Age of Gods - A VRMMO Story [Dropped For Now]
Age of Gods Online
Age of Heroes
Age of Heroes: Novus Gaia
Age of Immortal
Age of Others
Age of Revolution
Age of Swordsmen
Age of Swordsmen (dropped)
Age of the Dungeon Hunters
Age of Victoria
Ages Online
Aghori
A Ghost Life
A Ghoul's Legend
A Gift from the Heavens
A Girl and her Goat
A girl's experience as an incubus
A Girl's, Unusual Existence
A Gladiator's New World [HIATUS]
A Glass Window
A Glimmer in the Dark
Agnes of Raegma
A Goblin's Blade (dropped)
A Goblin's Evolution
A God in a Xianxia world
A God In The Bay (Worm/Massive Crossover) (Worm Quest)
A god's crime against humanity
A God's Freedom
A God's Fun Time
A God's Game
A God's Pub
A God's Purpose
A God's War
A God's Whim
AGON: Trail by Champion
A Good Bargain [HIATUS]
A Good Man
A Good Night's Rest
Agordos
Agorɔ
A Gray and Grey world
Agros de Mortis
A Guide To Immortality (discontinued)
A Guide to Rule the World
A Gun in a Dungeon
A Guy, A Latte and Status Screen.
A Hand-Woven Universe
A hard life.
A Healer's Gift, An Adventurer's Heart
A healthy mind in a healthy body
A Heart of Ice (hiatus)
A Hermit's Life for Me
A Hero Past the 25th
A Hero Past the 25th: Old Empire
A Hero Past the 25th: Paradise Lost
A Hero's Common Sense
A Hero's Legacy
A Hero's War
A Hero's Wish
A Hero to Only One. (Completed)
Ahh so it's another dungeon story with a long name
A Hidden World
A High God's Reincarnation
A Hunter's Wings [Rewrite]
A.I.
A.I. Actual Intelligence
AI immortal god soul
Aincrad Realized
Ain't A Hero
Ain't no Rest for the Wicked
Air and Nature
Airbound
Airi
Airi in a Thousand Worlds
Airium - Beta key
AI's Champion
A Jaded Life
A Jester And Smile
A journey in another world.
A Journey of an ordinary girl in a fantasy world
A Journey of Chaos and Glory
A Journey Through Frost and Snow
A Journey to Another Land
A Jump Into Fantasy
AkaTsuki: Book One [The Heart of A Samurai]
Akif Kas - Champion of the Arena
A King of Old
A King's Regret - Ravenchild
Aki's Abnormal Life
A Knight's Redo (Completed)
A Knight's Will
Akuma Karu
Akuma no Rune/ Rune of Demons Vol 1
Akuma no seifuku no fukushū?
A Lasting Fury By Replica1
A lazy king
A Lazy Programmer
Albert's Summer
Albion Live
Alctuz Arena
Aldemoor
Aldenia: The Lost
Aldernoh
Alea Ludo
A Legendary Tale: From rags to divinity!!!
A Legend Reborn
Alen Halfcup
Alen the Great and Mighty
Aleri The Return
Alexander Nightmare
Alex Mavros Chronicles (Dropped...)
Alfarome: Volper
Alfegenia-Inline
Aliad [Dropped]
Aliad - Tale of Zed [Dropped]
Alice
Alice.
Alice: Conquering Nightmare
Alice Devil Gift
Alice in Magic Land
Alice The Roaming Dungeon
Alien Me
ALIEN: Otherworld
Aliens! Tech! War! OH YES!!
A Life Like Fireworks
A life of excitement
A Life of Terror.
A Life Rewritten
A Life's Lie
A Lifetime Promise
Alios
Alison's Girls Ops SS: D.Eaters Gaiden
Alison's Girls Ops SS: Dimension Eaters Gaiden
Alistair's Great and Powerful Startup Dungeon
A Little Bit OF A Silverlining HIATUS
A Little Bit Of Motivation
A little bit of Villainy
A Little Evil Makes Them Cuter
A little Kitty's journey though a random world
A Little Sister'S All I Need | 我只需要一個小妹妹
Aliuor
Alive
Alive ?
Alive?
A-Live AI
Alive, once again
All
All alone on the long dark way(hiatus)
All Alone with You
Alland
All Encompassing
Allen: The Rogue A.I.
All into Agility
Allocation
All of The Angels
All-Powerful
All-seeing
All's Fair In Love&War
All-Star Buddha
All Stats Random
All systems rise to power.
All Things Must End
All Time Greatest Genius
All Trades Book 1: Master of None
Alluring Smile (Yāoráo De Wéixiào)
All World Online
Almagear
Almagear (V2)
Almavé
Almighty Dung
Almighty Hunter
Almisha's Journey
Almost Grimm
Alone
Alone No More
A long slumber.
Aloof Bard
A Lost Man
A Lotus Of Death
A Lover Siblings in Royal Road!
A love so divine!
A love to kill!
Alpha
Alpha After Omega: God Has Charged Me With Creating New Life.
Alpha Armageddon
Alpha - Book 1 in the Jaro Trilogy
Alphas & Omegas [Dropped]
Alpha Squad - Vecto: Vengeance
Alpha Test, Group One-tester
Alpha Zero
Alt Atelier
Alteratio
Alteration
Alter: Eclipse| The Chronicles of Gacaea | Book 1
Altered Destiny
Altered Tales
AlterGame, Book 1: The First Player by Andrew Novak
Alterlife
Alternate Amalgamation
Alternate Dreams
Alternate World Online
Alternative Reality
[Alternative Recode]
Alternative: To Love–Ru
Alter Tactics
Altrea: New sights from another world
Alucard Online
Always forward
Always Name Your Tools
A Magic Sniper in Another World [Hiatus]
A Magus Among Cultivators
A Maiden's Strange Voyage
A Mailman as a Superhero
Amalus
Aman
A Man and His Greatsword
A man with seven powers
A Mao's Tale
Amaron Online
A Martial Game
A marvel rise
Ambassadors to another world
Amber
Amber Silverblood
Amber Silverblood: Silverpack
Amber the Goddess of Time
Ambidextrous
Ambiguous
Ambition
Ambitions of an Immortal
A mean Demon Queen Kidnapped me!
A Meaningless Hero
Amending of the 'Evil' Pair.
A Merchants Tale
A Mere Fate of Mine
A Mermaid's Responsibility
Amethyst Phoenix
Am I a goddess? A devil? No, I am a lizard
Amidst the Final Sky
Am I friendly or hostile?
Amnesiac
Amnesia can be funny!
A Modern Day Demon King
Among Demons and Gods
Amongst the Stars
Among the Dead
Among The Stars
Among the tear soaked flowers
A Most Unfortunate Summoning
Amulet of Infinity
Amusement Park
A Music Prodigy
An Above Average Girl In A Fantasy World
An Academy for Villains
Anachronism
An adventurers tale
An AI in Eden
An A.I Is Such A Cheat In The Martial World!
Analytic System in Another World
An Anime Weeaboo in a Different World [Hiatus]
An arachnids way to Niflheim [HIATUS]
Anaraknakrium: The Cursid
Anarchy
Anarchy's Dungeon
An Artificer's Ambition
Anathema
Anathema of the Eldritch
A Nation of Riflemen
An Authors Chronicle
An author's massacre; the sudden appearance of the world, and its immediate cry
An author's new view
An Average Zombie's Path of Evolution
Ancestor, Wake Up! (Xianxia novel)
Anchore
Ancientblood
Ancient Blood Mage
Ancient Cultivator in Modern World
Ancient Fangs: Birth
Ancient Return
Ancient Ruler [ XIANXIA ]
Ancient Sins
Ancient Sovereign
Ancient World
And far was the walk.
... And My Skillet
Andraste
Andromeda's Tears
And then I made my own world
And the world breaks
And Thus, We Hoped
Andur's Oneshot collection
An Edgy Tale Of An Edgy Teen
An Egotistical Heretic's Reincarnation Doctrine
An Egregious Gentleman
An Elven Druid's First Adventure
An Empire Reborn (A Rebirth of Empire: Book 1)
An Empire Reborn (A Rebirth of Empire Series: Book 1)
An Empires Rising
An Enigma's Journey
An Ent-Like Existence
An ephemeral shroud
A Nerd's Wet Dream Come True (Tossing an OC into Marvel)
A Nerd's Wuxia Tales
An Everyday OP Player
An Evil Hero
An Evil Justice
A New Beginning By Aerebes
A new Breath Online
A New Breed of Pirate
A New Continent
A New Goddess
A new leaf (Old version)
A New Life
A new life in a new world.
A new life of a boy (working title)
A New life with the choice of destruction or creation in a new world(hiatus)
A New Life (zod119)
A New Loli Life On A Fantasy World!
A New Natural Order
A New Path, Chosen freely
A New Story
A new world
A new world a new Chance(DROPPED)
A New World: Eve
A new world for mad people
A New World? I'll Do What I Want!
An Exploration of Vulnerabilities
Angelborn
Angelic adventures
Angelica the Techno Ghoul
Angelic Knight Of The Mighty Zealot
Angelic Quest
Angel of Death
Angels, Devils, and Scott
Angels Without Wings
Angel Wing
Anima
Animated
Anime Apocalypse
Anime Clichés 101
AnimeCon Harem
Anime Dungeon
Anime powers in the Naruto world
Anime system in another world
Anime wheel of fortune
Anime World?
Anime Worlds System
An Immortals' Interaction with Modern Technology.
Animus Smith
Animus Storm
An Indomitable's Odyssey
A ninja transported to another world
An Interesting Journey
An Introduction to Being a Goddess
An Minecraft Adventure
Anna'dalia
Annals of the Snow Prince
Annihilation's Impact
Annihilation System
Anno Domini
ANNO DOMINI ~Allium~
Anno Iudicio
An NPC's Path: The Dead Rogue by Pavel Kornev
A Nobody Special
An Ode to the Birds
Anointed in Blood
An Old Villian's Tale
Anomaly
Anon: Goddess of Anonymity
An Ordinary Man
A normal man's journey
Another Apocalypse Story
Another Chance in Life: I am Alive Again
Another Day
Another Dungeon Report
Another End
Another Fantasy (Canceled)
Another Hero's Story
Another hero Tale: Nephilim
Another Isekai Story
Another Isekai Story!
Another life another chance
Another life (Loks123)
Another Me, But Cuter
Another Novel with OP MC
Another Ordinary World is Pink?!
Another practice
Another Regurgitated Piece of Garbage
Another Reincarnation
Another Summoned Fantasy
Another Terror Infinity Fan Fiction
Another TI Fan Fiction
Another Vampire Story
Another World
Another World and I'm still rich?
Another World? Never Saw This Coming
Another World Online
Another World Priest
Another World ; Rabbit Eyes
Another World: Scientist
Another World's Homunculus
Another world? Some weird magic? Sure.
Another World (Straightforward title, aye?)
Another World's Trespasser
Another world with the Bleach System
Another World with the Omni System
Another World With The Skyrim System!
Another You
A Not Quite Parallel World Story
A Not So Dark Soveriegn's Rise
A Novel World
An overly OP MC in another world.
Antagonist
Antagonist Rewind
Antagonist's Sidekick Becomes the Hero!
AntiGod
Anti-Hero: Journey of Fear
Ant in Magic World.
Ant Tensei (Original) and (Redux)
A Numbers Game
An Uncertain Fate
An undead's adventure
An Undying Coward in the Apocalypse
An Unexpected Adventure
An Unfamiliar Summon
An Unhinged Author
An Un-Ideal Eternity
An Unidentifiable being even by God enters a fantasy world
An Unlikely Haven
An Unlikely Jedi
An untold tale
An Unusual Town
-An Unusual VRMMO Experience-
Anya
Apathetic Hero (working title)
Apathy
A Peaceful World
Apex Legend in Another World [Litrpg/Dungeons]
Apex of Creation
Apex Predator
A Phoenix's life
A picture is worth a Chapter
A Pirates life isn't always gold
A Place to Belong - A LitRPG Adventure
A Player in the Greenwood
A Play ground for an Undead Lord
Apoaclypse. (DROPPED)
Apocalypse
Apocalypse?
Apocalypse 2020: Look to the Skies
Apocalypse : A New Dawn
Apocalypse in Russian style
Apocalypse?it was my snack
Apocalypse Judgement Day
Apocalypse : Judgement's Day [Rewrite]
Apocalypse Master
Apocalypse? No, it is heaven!
Apocalypse Now (Hiatus)
Apocalypse Now: Under Contract
Apocalypse on Endless Earths: Apocalypse How? A LITRPG Adventure
Apocalypse? Paradise.
Apocalypse Please(?)
Apocalypse Rebirth
Apocalypse, Sounds Like Fun
Apocalypse Step
Apocalypse Ted!
Apocalypse The Fantasy
Apocalypse war
Apocalypse Wishes
Apocalyptica: Vector's Edge
Apocalyptic Earth Game
Apocalyptic Evolution
Apocalyptic Trifecta
Apocalyptic World, Cheat
Apoch's Twilight
A Polite Society
Apollo
Apollyon, The God of Chaos.
'Apotheosis' By:Akirias
A Powerful Duke In Another world
Appetizing Magic
Apprentice of the Void
Approaching Ascension (Book 1)
A Practical Guardian
A Promise
A Protector's Circumstance
A Psycho's Diary
Aquaria
A Queen of Ruins
A Quest for a Cure
A Quest for Existence
A Questionable Persons Questionable Look At Life
A Question of Character (shelved)
A quest to reveal the truth of humanity
A ragbag of stories, don't expect them to end.
A Random story of an Adventurer
Arashia: A LitRPG story
Aratana hajimari (VRMMO)
A Rather Interesting Adventure
A Rats Life
Arbiter of Power (Canceled and currently redone as 'Re:' version.)
Arborea
Arcadia: Broken Paradise
Arcadia's Ignoble Knight
Arcadias Moon.
Arcadia: The End Game
Arcana
Arcana: The Rebel King
Arcane
Arcane Cycle
Arcane God Marcus
Arcane's Heart
Arcane Survivalist
Arcane Transmogrification (Book Two of the Pentacle Series)
Arc a New born titan [suspended]
Arcanist
Arcanum Astray - The Remarkable Adventures of Master Professor Lucius K. Henry, S.M. (Book One - Magic is Disappearing!)
Arch
Archaic Avalon
Archaic Transmogrification (Book Two of the Pentacle Series)
Archangel
Archillies Duane : The World Traveller
Arch, Inc. - Secret Origins
Archipelago: Relics of Wonders
Architect of Dominion (The Darius Kane Chronicle)
[Archive] Legend of the Nameless Hero
Archive of James: Origins.
Archive of the World's Transfer Chronicles
Archmage Father
Archmage of the Future in the Past
Archmage Paladin
ArchMagus
Arch Magus, The Wich Hunter
Archon
Arduous New World
Area 51
A Real Life
A Reaper's Tale
A Reason
A Reincarnates Story
a Reincarnation full of choices
Arena Earth
Ares
A Retired Vets New Life: An Apocalyptic Novel
Are you a Lucker? (Luck based LitRPG)
Are You For Real!?
Argent Chaos
Ariair Online
Ariana (On Hiatus)
Ari and her pet rock.
Arianna's Wish
Aria of Tao
Aria of the Sun and Moon
ARIA Online
Aria Wanderlust
Aries
A.R.K
Arkandia
Arkhay (Writers block on this story..Sorry guys. might never add more)
Arktoni - The Adventure
Armageddon: A Biography of a Forgotten History
Armageddon: A New World
Armageddon Online - Escape
Armbuster
Armored
Armor of Justy (AoJ)
ArmourXDemons
ArmS: The Last Human [dropped]
Army of the Fallen
Arnar the Dungeon
A Road To New Discoveries by Glitch
A Romance of Villains
A Rotten Soul
A rotten soul (short hiatus)
A Royal Warrior
Arpeligo
Arp Shinano's World Slip
Arrogance is justice!?
Arrogance: Lost reports
Arrogant Master In The City
Ars
Ars Arcana
Ars Utopia: A Fantasy Dystopia Story
Artanis Road
Artemis The Celestial Beast(Hiatus)
Artfin, Power Money and Woman [Dropped]
Arthron ~It seems I become a newbie god~
Arthropod Online
Arthur ReD
Arthur's Quest
Arthur "The successor of the god of time"
Artien
Artificial Biological Runic intelligence
Artificial Devastation
Artificial Light
Artificial Seed
Artificial Selection
Artificial Selection: A Near Future Thought Experiment
Artificial War
Artificial Yuusha
Artisan
Art of Alchemy
Art of Poison
Art of War
Arts Master
Art Sword Online | アートソード・オンライン
Arum: Reconquering the Dungeon World
Aruna
Arun Online [Dropped]
A Rush and a Push
A Safe Place
A saga of Alviona, a girl who would be known as Crimson Queen
A Sage's Different World Logs
Asaris Online
A Saviour's Endeavour
Ascend
Ascendance
Ascendancy
Ascended
Ascended Dark Sovereign
Ascending
Ascending Hero
Ascending The Heavens
Ascending Trinity
Ascend Online
Ascend to Be GOD
Ascension
Ascension Alphas
Ascension: Birthright
Ascension Core: A Cyberpunk Story
Ascension: Fall and Rise
Ascension From Nothing
Ascension of a Reborn Woman
Ascension of Shura
Ascension Online
Ascension: Razor's Pass
Ascension Rebirth [Dropped]
Ascension: The Helm of Lentha
Ascension VR
As darkness takes thee
A second chance in a new world
A second life
A Second Reality by Masadeer
A series of Short stories
A Serpentine Tale {Dropped}
A Servant of The Empire
Asgard's First Elemental Necromancer
Ash
A Shade of Timeless Retribution
A Shade's Joy
A Sh Ai El
Ash Burst
Ashen Ghost
Ashen Lord
Ashes
Ashes *Hiatus*
Ashes of the Arctic
Ashes of the Primordial
Ashura, Heir Of Rebirth
Ashura- The Demon Sovereign
Asiad the land of lords
A Sick Twist of Fate
A simple book
A Simpler Reality ( Revised )
A Single Thought
A Siren's Call
A Sister'S All You Need | 如果有妹妹就好了
A Skill Whore's Journey
A Skin-Changer's Tale
A sky as blue as ours
A Slave's Voice (Revision Pending)
A Slice Of Life Of Broken Man
A Slip Of The Force
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon?
A Small Boy's Dream (Dropped)
A Smile To Remember...
A Snail's Wisdom
A Snake's Life
A Snake's Rise
A Soldier's Fragmented Memoire
A Soldier Tale
A Song for the New Age
A Song of Goblins and Skeletons
A Sorcerer's Footsteps
A Soul Bound Dragon
A Soulmage's Shadow
A Soulmage's Shadow (The Wellstone Saga)
A Soul's New Home
A Space Odd-yssey?
Aspect of the Beast
Aspects of Heaven and Earth
Aspiring Demon Lord
Assassination System V.2
Assassin Gamer [HIATUS]
Assassin God
Assassin or Princess? Why not both.
Assassin's Child
Assassin's Decree
Assassin's fate
Assassin's Revival
Assassin Type: The Rifle Girl- Rica Reyes
Assault The World
A Step Behind Death
A Step into Madness (Dropped)
As The World Spins
Astlan's Ira
Astoerith Online
A Story About a Vampire
A Story in Black and White
A story in which numerous people die
A Story That You Wouldn't Want To Read +
A Story To Choice From (10 One Shots)
A story where the main character is too Op!
Astral Arcana: Ethereal
Astral Bridge
Astral Desire
Astralis Lumen
Astral Land : The Beginning of Everything
A Strand of Divine Sense
A stranger in a new world
Astrayed Absolution
A Struggle Through the Deadly
A Students Gate to Hell
A Succubus System? But I'm a Virgin!
Asunder Online [Indefinite HIATUS]
A Superhuman Family In Another The World?
A Superior Being Will Always Rise ... Even If They're A Goblin
A Super Robot story.
Asura
Asura Ascending
Asura Swiftblade
A Sword Master's Travels (1)
A Tactician's Mind
A Tail's Misfortune
A Tale of a Certain Lolicon
A Tale of a Different Hero
A tale of a girl and her shadow
A Tale of Casual OPness
A tale of forgiveness
A tale of Might and Magic
A tale of nonchalance and tomfoolery...
A tale of teleportation
A Tale of Two Shadows
A Tale of Two Sisters
A Tale of Two Worlds
A Tale of Villainy
A Tale of Winter
A Tale To Tell
Ataraxia Sanctuary
A Taste for the Finer Things
ATCS Ability to Change Size
At Death's Door: Legacy
A Ten Year Vacation Turned Me Into A 14 Year Old Kid
Aterheim
A terrible field trip
At Greater Than Asterisk Bracket equal to J circumflex Two Less Than C
Athanatos
A Thiefs Tale
A Thousand Year Old
A Thousand Years Queen
A Time for Leisure
A Time Where I Travel, In Time
A Tingle Later: A Different Kind of Hero Tale
A Titan's Crusade
Atlantis
Atlas Code
A Toaster Story
A Tomb of Dead Stories
Atonement
Atonement of an Immortal
Atone Online
A Tower Of Dreams
A Trace of Heroism
A Tragedy for a Demon Lord
A Train Between Worlds
A Trap in Another World
A tree's simple life
Atreo "The Delusional Demon Prince"
A Trinity of Passion,Mind, and Strength: Deception of Misdirection
Atros Imperium
A Truck Driver's Tale
A True Queen's Life
Attached
At the Top of the Food-Chain
A Twist that Lead to the Fall
At Wit's End
A typical fantasy Journey
A Tyrant: Unshackled
Audacity Light
Auf der Seite der Nacht (German / English)
A ugly swan
Augmented Insomnia: A LitRPG Novella
Augmented Reality
Augmenting Reality
A Universal Tale
Aurelia Online
Aurora
Aurora Eclipse
Aurora's Sky
Ausfagner: The First Exogenous
Authority
Author Rebirth To The Douluo Dalu World
Author sent into his own story, now what do I do?
Author the book-world's creator
Author Vs Protagonist
Autonomous Machine Arsenal: An Evil Machine's War Record
Avalon
Avalon: New settlers
Avalon'S King
Avalon's Shards
A Vamp's Ire (Hiatus)
Avant Garde
Avaritia
Avast Online (DROPPED)
Avatar of Nature: The Enchantress
Avatars
Avatars of Myths and Legends
Avatar: The Wild Lands (A Medieval 'Avatar: The Last Airbender' Fiction)
Avenger
Average Slime
Averno
Ave Xia Rem Y
Avian (DROPPED)
Avian | Krieg der Welten (German!!!)
A Vile God- PilotFlux's first work.
Avine: The Journey
A Viral Life
A virtual reality game according to a martial artist otaku
A Virus Life For Me
Avitus Volten's journey through space and time
A Vixen's Blood
Avoid Destiny
Avoiding the Heroine and Capture Targets!
Avonlea
A Vorrgistadt Shard - The Shattered Oracle
A VRMMORPG Adventure: The Legend of the Legendary Rogue!
Awaken
Awakened (A Precursor to the Pride X ReVamp Universe)
Awakened Cheater
Awakening
Awakening: Elemental World
Awakening in Ruins
Awakening of a Monster
Awakening of an Anomaly
Awakening of the Unknown
Awaken Online
A Wanderer's Story by Dms143
A War Beyond Kings
A Warlock From Elsewhere
A Warlock's Luck
A Warlords Origin
A War of Galaxies: The Things I've Seen
A Way of Life
AWE: Adventures of a Reincarnated Noble Android Girl (Rebooted)
AWE: Ballad of 3rd Crown
Awe, come on man, really, Again!
Awful garbage
A Whisper Among the Stars
A Whole New World
A Wicked Tale Of Witches, Wands, Booze, and Swagger
A wish for ordinary day
A Wish For Power
A Wish Of Change
A Wish Upon The Stars
A witcher cultivator.
A Wizard of the past
A Wizard's Birth: Awakening
A Wizard's Sacrifice, Book Two of the Woern Saga
A Wolf's Journey
A Wolf's Way
A Wonderful Adventure in a Wonderful New World
A World Beyond
A world born from ashes (undefined hiatus)
A World Forgotten
A World of Many
A World of My Own
A World Reborn
A world travelers problem
A World Traveller
A World With Nothing Normal
A World Without a Tomorrow
A World Without Them
A world with two moons
A writer's legend
Axe from North
Axiom
Ayla's Junkyard
A young girl is my master and I'm son of the demon king?
A'Zaat The Ghorfa
Azalon
Azarinth Healer
Azeal Neralum
Azeria: The Era of Black Flowers
A-Zero
Azran - Magic King of the Darkness(Finished Volume 1/Dropped Volume 2)
Azura of The White
Azura the Slayer
Azure Warrior
B1nary Bl00d
Babel
Babel - The Path To Ascension: Heaven
Babel - The Path to Ascension: The Golden Children
Back Again
Backstabber
Back to Day One (On Hiatus)
Back to Pokemon and Earth
Backyard, cute cat eared girl changing her clothes, spirit magic to make breads and saving the world
Backyard Hero
Bacterium
Badass
Bad ass Bunny - A lack of common sense isekai for no reason.
Bad Company
Bad Habits {New!}
Bad Intentions
Bad Light Era
Bad Luck World
Bad Prey
Baka!! LYFE!
Balada: When death did not exist, nor yet Eternity Part I
Balance
Balancer-Shattered Soul
Ballad of Failure
Ballad of Mortals
Balthazar, a case study
Bandit Host Club
Bane Blood (On Hiatus)
Baphomet the Destroyer
Barakdor
Barbarian Game
Barely Human
Barliona: Spiel ums Überleben (Der Weg des Schamanen, Band 1)
Barrow of the Lost
Base Affection
Based on a Life
BASE Status: Online
BASE Status: Online [An Unlikely Hero's Journey]
Bastard Assassin (18+)
Bastard's Wrath
Battle Avatars
Battle City: Rise Of The Blue Spark
Battlefield Reload
Battlefield Restart
Battlefield Restart [Reboot]
Battlefront
Battle is an Art
Battle Maiden
Battle of Lexis
Battle of realms
Battle Of Supremacy: Heroes and legends
Battlesquire Book I - First Blood
Battling for Survival in a New World
Battling for Survival in a New World (On Hiatus)
Battling the World
Bayani
B-But I don't WANT to be a protagonist!
Be a man, be a hero
Beanstalk
Bearer of the First Flame
Bearer of the Red Lotus
Bearer of Time: Haze
Beast
Beast Cultivating System
Beast Dao Cultivator
Beast(Dropped)
Beast fiend
Beast God
Beast Knight
Beast mage
Beast Master System
Beastmastery - A LitRPG Novel
BeastMaster Zero By justTYM
Beast of the Mountains
Beast Queen: A LitRPG/GameLit Action/Adventure (book two of Monster Slayer Online).
Beast Slayer
Beast Tamer Kayne
Became the Strongest Cultivator Just By Existing
"Because I am Tianzi Daiyu!"
Because I do not fit well with my life, I am given a restart!
Becket The Elf?
Become God
Become Immortal
Becoming
Becoming a God
Becoming a mesiah
Becoming God
Becoming Itachi Uchiha in a Different world!
Becoming Renegades in Another World!
Becoming the Protagonist of My Own Delusional World!
Becoming The Wolfman
Bedlam - A litRPG Novel
Bed of Glory: Conqueror Of Worlds
Before a Legend
Before the Day Is Done
Before the Fall
Beginnings
Behemoth
Behind
Behind the Mask
Behind Your Smile | 你的笑容
Behold the Bacterium
Being
Being an adventurer is harder than it looks!
Being chased by the heroes because I am a Master Puppeteer.
Being Frank
Being God is Fun
Being Human (Completed)
Being in the Grey : Awakening
Being summoned into another world isn't so great after all...
Being the God of Hell is a bother
Being Undead
Belief Can Create Gods
Beloved Protection from a nine tailed fox
Beloved Sin
Below The Distant Sky
Benjamin
Benjamin's Account of Adventures
Ben the Dungeon
Best Friends Forever?
Best of Luck
Beta Life, Digital Sorcery Book 1 (A LITRPG Adventure)
Beta Testing for Implementation of Status and Power
Beta Zero
Betrayed by Light
Betrayed in a Blessed World (Web Novel)
Betrayer of Humanity
Better Days
Better than one
Between Heaven and Hell
Between the Border
Between the planes
Between War and Magic
Beware of Darkness
Beyond
Beyond?
Beyond Blue
Beyond Death:Monster
Beyond Floating
Beyond Foundation
Beyond Gods
Beyond life
Beyond Mortality
Beyond/Odyssey
Beyond The Abyss (Rewrite)
Beyond the Balance
Beyond The Game
Beyond the Horizon
Beyond The Other World
Beyond The Primordial Void
Beyond the Stars
Beyond the Star Ways
Beyond The Wall (Complete)
Beyond Time and Space
Beyond Truth
Beyond Worlds
Binary Blood
Binary Soul
Binded
Binge Eater [DROPPED]
Biomancer: Songs of Sirens
Bio Synthesis
Bird of Ill Omen
Birth Cult
Birthday Online
Birth From Darkness
Birth of A Death God
Birth of a Devil
Birth of a God
Birth of a Monster
Birth of Mana
Birth of Sin
Birth of the Dragons
Bitten
Bitter
BKR: Bandit King Reborn
Black And White
Black Beast
Black Blood
Black Blood (now on break... it'll be back... Eventually...)
Black Book Saga
BlackCrown
Black Dragon Rising
Black Dragons Rain
Black Feather
Black flame Devil
Black God of Lightning.
Black Heart
Black Home
Black Ice
Black Iron & Cinder
Black Kingdom By CallMeDeliverUs
Black Knight
Black Magic
Black Magic Hero
Black Meridian
Black Mist: Daniek of the Black Blood
Black Moon
Black Pawn
Black Sheep
Black Sheep - A Permadeath Book
Blacksmith
Blacksmith of the Ancient
--Blacksmith's Ire, Book 1 of the Vengeance of the Wind Trilogy--
Black Space
Black Storm
Black Sun
Black sun, devil's curse
Blackthorne
Black Tiger God (黑虎神)
Black Titan
Black Watch Asylum (Hiatus)
Black Wind
Black World
Blade
Bladed Advent
Blade Familiar
Blade Judgement
Blademage Beastmaster
Blade of Avenel
Blade of Chaos
Blade of Death
Blade of Gaia
Blade of shattered reality
Blade Origin
Blades and Bonds
Blake Byron: Paranormal Investigator
Blame (Hi-Chan)
Blank: a Story of Good Intentions
Blanks: Magi Of The Red Desert
Blankspace
Blarg the Meh Ai
Blaze
Blaze contractor
Blazing Translocation
Blessed
Blessed be his name
Blessed with a curse (BwC) [Tryout.]
Blessing
Blind
Blind man's path
Blind Punch
Blind Spear Goddess
Blind Strings
Blinker
Blockage of Writing
Blood Amongst the Sand
Blood & Void Division - Broken Fate
Blood and Bones
Blood and Honor
Blood and Iron
Blood and Magic
Blood and Sacrifice
Blood and Silence
Blood Born
Bloodborne
Blood Conqueror
Blood Creed
Blood Drinker
Blood Drive
Blood Emperor
Blood Emperor [Dropped!!]
Blood for Blood
Blood Fractal
Blood is dark
Bloodless
Bloodline
Bloodlines
Bloodline: World Domination
Bloodlust
Blood Mage Bastard (A LitRPG)
Bloodmoon Destiny
Blood 'n' Death
Blood of an Inhuman Hitman
Blood of an Inhuman Hitman (Rewrite)
Blood of Lilies
Blood of the Evil God
Blood of the Guardian
Blood Pendant
Blood Princess (completed)
Bloodreign
Blood Rising
Blood Seekers -- The Monolith
Blood Shark
Bloodshed
BloodSmeared
Blood Virtuoso
Blood Virtuoso: a goblin's story
Blood Virtuoso: a monster evolution story
Blood Virtuoso: an evolution story
Blood World - Sacrifice
Bloody Angel
Bloody Conqueror
Bloody Creed: Mortem Iuxta Est
Bloody Dragon
Bloody Grass
Bloody Hell
Bloody Killing Game
Bloody little Monster
Bloody luck
Bloody New World
Bloody Wave Unlimited
Bloody Wonderland
Bloom
Blooming Thorn in Another World
Blue Alchemy Law - Days of Reincarnation
Blue Blood Servant
Blue Cruelty
Blue Domain
Blue Hills
Bluelight Chronicles - Going Solo
Blue Mist
Blue Moon Emperor
Blue Moon Saga
Blue Moon Saga (R&Y Edition)
Blue Phoenix
Blue Pill
Blue Screen Society
Blue Seed
Blue Seed - Path of a Mage King
Blue Star Cultivator
Blur
Blutopfer (HIATUS)
Blut und Eisen: Blood and Iron
Bob in the land of the gods
Bob the mighty or fred the awesome
Body and Soul
Body Molder
Bogatyr
Bolt
Bonds of a Brother: The Iron Cross
Bone...r?
Bones
Bonfire of Souls
Boogeyman
Book 1: A certain magic kingdom
Book 1: Demonic Wolfsbane
Book 1 of the Falconer series: Hearts of Ice
Book 1 of the Immortal Sun Mist Emperor Saga- Novus Magus
Book 1 of the Immortal Sun Mist Emperor Series- Novus Magus
Book 1: There is No God
Book 2: The Legend of the Four Guardians
Book of Creations
Book of EscaLod
Book of Heroes - Rise of the Shadow Walker
Book of Kindness
Book of Liz
Book of Monsters
Book one: Change
Boop!
Borborygmi
Borderlines
Bored Evil
Bored Hero
Boredom Made Me Do It.
Born a Demi-God (Hiatus)
Born a male xenomorph
Born among the Stars
Born to Heal, Grown to Steal
Born under the moon
Born with a Dragon Tattoo(Dropped)
Borrowed Time
Boss
Bottled up wishes
Bound by life and death
Boundless (Completed)
Branch Adventurers Guild
Brand New Night
Brand New World
Brand of the Dragon
Brave Soul
Bravest Soul
Brave World Online
BreakDown
Breaker of Chains
Break Fate
Breaking Chains
Breaking Syd
Breaking The Barrier
Breaking the Mold
Breakout: The Evolution of a High School Nerd
Breakthrough
Brian'S Note Book
Brian the Drow: A LitRPG Adventure
Briars and Thorns
Bricks of The Temple
Bride of Prince
Bright Battle Story: Tactics Heart
Brightest Alpha Star
Bright Night Online
Brimstone Fantasy
Bringing Anime Skills to Another World Using Imagination
Bringing Chaos to the Immortal World with God's Powers
Bring it on
Brink
Briox the Magus
Broderick's Home for Curious Kids
Broken
Broken Cheat
Broken Edge
Broken Fate
Broken Horn: God of the Apocalypse
Broken Lance
Broken One's New Life
Broken Reality
Broken Realms: Battle of the Gods
Broken Shards
Broken Soul (MoTheGreatOne)
Broken System
Broken : the story of a shattered soul
Broly In Naruto
Bronze Mirror
Brujas de la Noche
Bruxas da Noite
Bubin
Build-A-Harem (ongoing)
Building an evil corporation for some prestigious soon-to-be pensioner in a fantasy world? (Prequel)
Building Home
Building Home Book 2 - Rescue
Building my faction in another world
Building the Star Forge Empire
Bumi
Bunkercore
Burn Artist
Burned Phoenix Rises
Burning Heavens
Burning Winter
Burra: A Collection of Short Stories In the Shaper Universe
Burra: Short Stories In the Shaper Universe
Business Manager in a Barn
But I never wanted to be involved
Butterfly's Dream
Bystander effect(dropped)
Caelorum - Online?
Calamity
Calamity Blade
Calandoris
Caligo Tenebris
Calla
Called Upon
Call of Carrethen
Call of Geminus
Calm Calamity
Cambion
Camelot Defiant
Camelot Dungeon
Camelot Overthrown
Can an elder lich become an adventurer?
Canary
Candor: The Forgotten House
Candor: The Lost House
Can I Borrow @You?
Can i please get a female demon lord on the 10th world(Hiatus)
Can I really keep my Goddess Wife to myself and away from all the Crazy OP MCs?
Can I really make money this way?
Canticle: Code Caligula
Cantina KnowWhere
Captive God
Card Game
Card Master System
Cards of the Royal Guard
Carefree Cultivation
Careless Wish
Carnage
Carnival of Curses
Carnivores: Aurora
CarryOn Crowe
Cartilage Of Life
Cartoon Vs Rpg World[Working Title]
Carving a Path
Casa do Diaño: The Fool
Case Notes: L0St
Cassidia
Cast
Cast 2
Casted Away {will probably change the title}
Castlebound
Cast Out
Casus Belli
Catalyst
Catastrophic world
Catch All The Girlfriends!
Catch Me If You Can (a PicYourStory entry)
Catch the Wind
Catmaster Online: A LitRPG Series
Cause and Effect
Cave Crawl
Cave of the Fallen
Caveship
Caves of B´lo
Cecidit Mundi ; Fallen World
Celeste Academy
Celestia: Chronicles of Wyrmhaven
Celestial Beings
Celestial Black Star
Celestial Child
Celestial Fox
Celestial Games
Celestial Games (Book 1) Original
Celestial Magus
Celestial Reaper
Celestial Void
Celestial Wind (Book One of the Virtuous Series)
[Censored]
Centifire: Deciphering Magic
CerberuS Awakening
Ceusawah
Chained
[Chained Abyss]
Chains
Chains of life
Chains of logic
Chains of Servitude
Chains Saga -
Chain Warden
Chain Worlds: In the Name of the Allfather
Chain Worlds: Rise of Three
Chain Worlds: The Third Fleet (Completed)
Challenged Dungeon and the Arrival of Mana
Challenge: Get Atsuko a Great Life!
Challenging Destiny
Champion is Playing
Champion of Death
Champion Of Goddess Of Light
Champion of the New World
Champion of the Smith
Champions
Champions of the Boundary
Champion's Path
Chance for Change
Changed Soul
Change Is Inevitable
Change My Heart, Change My World, Change Me
Change: New World
Change's
Change The World
Changing Fate
Changing Oneself
Changing World
Chao Mundi
Chaos
Chaos Children: Devourer
Chaos Cloud
Chaos Destiny
Chaos Dragon
Chaos Fiend in the Naruto World
Chaos Fountain | A Chronicles of Ascension Novel
Chaos Godking
CHAOS ONLINE : Paradise of Criminals
Chaos Rising
Chaos Traveler
Chaos Traveller
Chaos Wave
Chaos World Chronicles : Dissolution of Cascany
Chaos Zone online(CZO)
Chaotic Berserker
Chaotic corner
Chaotic Emperor
Chaotic|Nonsense
Chaotic Shadows (Temporary Name)
Chaotic Soul
Chaotic Souls (Dropped...)
Chapter and Verse
Char
Character Wonders
Charlotte Powers: Diary of a Would-Be Superhero
Charmed?
Charon's Oar
Chase the Thrill
Chasing Freedom
Chasing Legacy
Cheater God
Cheat Hero
Cheating Monster
Child God
Child of Fate
Child of God's Fantasy
Child of God's Fantasy (HITAUS UNTIL FURTHER NOTICE)
Child of Mystery
Child of Night
Child of Nightmares
Child of Terra
Child of the Empire
Child of White
Children of the Arcana
Children of the Singularity (S4)
Children of The Sky: Heartcore
Children of the Sun (Ancient
Chilledren
Chillin' in a dungeon
Chimera
Chimera, The Unwilling Familiar
Chivalrous Thief
Chocolate Obsessed Genius Mage
Choco Parfait
Choice
Choice of Fate: Online
Choice of the Last
Choices
Choose 3
Choose Your Class
Chopin's Penny
Chopin's Penny :: (The Reincarnated Diaries of 'The Ant and Grasshopper' through a Classic Composer and a Lazy Witch)
Chosen
Chosen Fate (Reincarnation Giver)
Chosen of Death
Chosen of the Mirth
Chosen of the Veiled God
Chosen Shackles
Chosen (Temp Title)
Chromatic Caverns
Chromium
Chronicle of the World
Chronicle Online
Chronicler's Tale
Chronicles of a dark lord
Chronicles of a Dungeon Core
Chronicles of a Dungeon Core (Side Stories)
Chronicles of a former God - the lives of Vince and Remus
CHRONICLES of a PC Gamer Stuck Inside an RPG Book One: Duelist
CHRONICLES of a PC Gamer Stuck Inside an RPG (Book Two: Successor)
Chronicles of Arrath
Chronicles of a Watcher
Chronicles of Creation - Tale of the Elder Witch
Chronicles of Genticus: Invasion of the North
Chronicles of Grand Deus
Chronicles of Gray
Chronicles of Heroes: The White-Fire Covenant
Chronicles of Ionathan Spellweaver
Chronicles of Leofric [Dropped]
Chronicles of Mana
Chronicles of Nick Holster
Chronicles of Phartassia: My Teacher, Fox
Chronicles of Soma: Rise of a King
Chronicles of Sora: All over again
Chronicles of Sora: Ruler of Rules
Chronicles of The A.I
Chronicles of the Blade By GnomeBob
Chronicles of the Dark Mage
Chronicles of The Dragon Empire: Rise of the Dragon King (Rewritten)
Chronicles of the End
Chronicles of the Last Hermit
Chronicles of The Magical Sword Sovereign
Chronicles of The Random , Unfinished Stuff I Wrote.
Chronicles Of The Storylord: 12th Chronicle - Origin
Chronicles of the Survivor
Chronicles of the Sword Dragon
Chronicles of the Tiger Immortal
Chronicles Of The Voidbearer
Chronicles of the Wanderer, Siúlóir
Chronicles of the Weakest Wind Mage
Chronicles of Thyderalis - A Hero Returns
Chronicles of Trial and Error
Chronicles of Trial and Error (re-write)
Chronicles of Zach
Chronokinesis
Chronology
Chrysalis
Chuunibyou in Cultivation World
Cielo Pantasia
Cinap: Academy
Cinder Souls II
Cionis Key
Ciphered Realm: A LitRPG Adventure
Circle of Shards
Circle System
Citadel World: The URANUS code
Citizen Rat and Other Stories
City dungeon
City Dungeon Abyss
City of Champions Online
City of Darkness
City of Devils
City Of The Banished
Claimed by the Gods
C l a i r e
Clan of The Alchemist
Claret
Clash of Cards
Clash of Gods
Clasp of the Titans by Phatataz
Class Crystal Battles
Class: God-slayer
Classless[Dropped]
Classmancers - A MOBA Esport Story
Class: Master of Time
Class: Space Marine
Clay the Golem
Cleaning Up The Future
Clean Slate
Clear
Clear Binding
Clear River Flowing Silently
Clerical Error: A Challenge of Vircon Adventure
Cleric or Necromancy?
Cliche?
Cliché cliché the classic cancer cliché
Cliché Fantasy I
Click here..... Trust me its good :D
Clock Link: A Story of Magic and Murder
Clockwork
Clockwork Memoria
Clockwork powers? Sure! Wait, why am i on a fantasy world?
Clockwork Revenant
Closed Beta [A Star Nova Prequel]
Cloud 9 Rebirth: Adventure In New Dwarden (Working Title)
Cloud Academy Aerendel
Cloud Dungeon
Cloud Shrouding the Sky
Clover: A Seeker's Story
Clue
Clyde and Pup (short story)
Coachman's Voyage
Coda's adventure
Code;
Code Antony
Coded
Code Death[Dropped]
Code Hero (Champion Is Playing Book #2) LitRPG Series
Code Jumper - A GameLit Novel
Code name [Blood Cry]
Codename: Freedom - When VR Gaming Hurts
Code Name: Genesis
Code: Ragnarok
Code Red
Codex Haereticorum
Codex Haereticus
Codex of Shadows
Codger
[COE] blood moon
Coeus?
Coffee & Slime
Cognata: A Vampire Romance
Coiling Dragon: Untold Stories
Coin
C.O.L.A. Beration
Cold
Cold Expanse
Cold Space, a LITRPG space story.
Cold Steel Dig
Cold Sword Mistress
Collection of short Stories
Collector's Guild
College Student To Chosen Hero
Collision of Myths
Colors
Colosseum 72
Colossus' Dream
Combat Chef
Combat Gods Reawakening (Remake)
Come Sevenfall
Coming Down
Comm.
Commander Daggen
Command Line: Failure
Commoner Online
Compilation of short stories
Completely Lost (Dropped)
Conba Shiroppu
Concept of the Novel
Conclave of Tyrants
Concordant Fall
Concrete Chaos
Confessions of a 22 year old Introvert
Confinement
Conflagration - A Fantasy Haven Series part 1
Conflicted Feelings
Congratulation, You got the Job!
Conjured Villain
CONNECT: Martial Dimension
Conquer
Conquer Everything
Conquering The Heaven
Conquering the World as a Goddess
Conqueror
Conqueror Online: Soul Summoner
"Conquerors Domain" By xipzo
Conquerors (Dropped)
[Conquerors Of The Delve] [Abandoned]
Conquer the World
Conquer Your Own Fate
Conquest: A LitRPG Story
Conquest Apocalypse
Conquest of Arcadia
Conquest of the Evolutionizing Extraterrestrial Being
CONQUEST: The Dungeon Core Gambit Book One (SAMPLE)
Consciousness Error
Conscripted
CONSOLE ~Another World Transfer Chronicle Starting From the Conversation with God~
Consor
Constantine
Constellations
Construct Your Fate
Consume
Consuming Earths, Devouring Skies
Contact First
Containment Pacific
Contient of Reims by Sibs
Continental Chaos
Continental Wars
Continue Online - Sample
Contract; A Bless with a Curse
Contract from the Abyss
Contractor of Flames
Contract: Restart
Control + Alt + Sadit
Controllers
Control the Universe
Convergence of Fates
Convergence of Night
Conviction
Cooking with Oinos
Copyright [HIATUS]
Corbeau
Core
Core .001
Core of Metal, Heart of Blight
Cores
Core Wars
Core Worlds
Cor Navim
Correcting My Martial Path
Corrupted
Corrupted Guardian
Corrupted Ones
Corrupted soul
Corrupter of Worlds
Corruption
Corruption of the Demon Lord
Coruscant Ela
Cosmic Planes
Cosmos
Cosmos-Slaying Calamity Blade
Cosmos Traveller
Counter Magic
Counterpart
Counterwizard
Countless Minds
Coupe - The Art of Rebellion
Couplet
Coveted
Cracked Coffins {Book One}
Cradle
Craftsman of Blood: Demonic Beginnings
Craft Spirits
Crafty devil
Crain Chronicle
Crash Alive
Crashed Into Fantasy
Craving for Potions (RAGEQUIT)
Crazy Blacksmith
Crazy Diamonds
Creases and Folds by Origami
Creating A Continent of Magic
Creating a World RPG
Creating a world [Russian]
Creation - The Path of a God
Creative thinking is everything I have
Creator
Creator Advance
Creator (HIATUS)
Creator of Worlds
Creator's Mistakes: Martial Realms of Elements
Crest Fallen
Crestruction
Cries from the Dust (Working title)
Criminality : Sunset City
Crimson
Crimson blade
Crimson Contact
Crimson Crown
Crimson eyes in a world of cultivation.
Crimson: Life in the Virtual World
Crimson Marble
Crimson Moon
Crimson Night Sect Young Ancestor
Crimson Pervert
Crimson Qi
Crimson Sky
Crimson Snow
Crimson Violet
Crisis
Crisis Dogma
Crisis Zero
Critically Impaired
Crocodile Reincarnation Story
Croenas story of creation
Cross Gun
Crossing Bullets
Crossing Paths with a Snake
CrossRoads
Crossroads - Tournament of All
Cross world crisis
Crowmakers
Crowned Divinity
Crownless: Veni Vidi Vici.
Crown of Darkness
Crown of Heroes
Crows Feast
Crucible - A Lost Dungeons Tale
Cruel reality
Crushed and Cursed
Crushing Hearts
Crutch: Origins by Spoon
Cry of the Mer
Crysolis
Crystal Core
Crystal Creature
Crystal Evolution! The Tales of a Ruler Crystal!
Crystal Guardian
Crystal Guardians: Light Novel: Volume 1: The Girl With Eyes Of Blue
Crystal Heart
Crystal Magic
Crystal Realm Online
Crystal Shards Online - A LitRPG Series
Crystal Trouble.
Cultivating Civilization
Cultivating Dungeon
Cultivating Elf
Cultivating Magical Kingdoms 🌱✨👑
Cultivating Monster
Cultivating Queen of the 13th Realm (slow releases due to me being lazy)
Cultivating the Cosmos
Cultivating the Universe (Temporary Hiatus [Until June])
Cultivation at Home!?
Cultivation Bug Fuyo
Cultivation Is Now A Reality
Cultivation of a Phoenix
Cultivation Online
Cultivation Queen
Cultivation Sect in Great Age of Piracy
Cultivation System
Cultivator in a Magic World
Cultivator in Narutoverse
Cultivator In The Magus World
Cultivators are extinct!
Cultivator's Fantasy
Cultivators: Journeys (Hiatus)
Curiosity Didn't Killed the Dungeon
Curiosity killed the cat
Curo [Hiatus]
Cursed Anti-Hero Against the Gods
Cursed Armor Reincarnation
Cursed by a goddess...
Cursed by hatred
Cursed by mistake
Cursed child
Cursed Children
Cursed Era
Cursed World (LitRPG Fantasy Adventure)
Curse from God, Live a Thousand Lives: Second Life
Curse of Change (Hiatus)
Curse of Eitr
Curse of The Dark Side
Curse of the Forsaken
Curse of the Kat
Curse's Curse (On-Hold)
Curse X Prayers
Curves of the Game
Cute Psychic
Cutthroat
Cy
Cyberhawk
Cybernetic Monster Lord
Cyber V - RoyalRoad Edition
Cyberworld ALICE: Terror Rising
Cyber World Alpha
[Cyborg] - In A World Of Magic
Cycle of the Tides
Cyrus: Return of The Persian Monarch!
Czar Of Combat: Kings
Daedalus
Daemon: A tale of darkness
Daemon Born
Daemon Dungeon Core
Daemonia Graveyard
Daeva
Dagon, Dungeon evolved
Dah Ork Life!
'Daikon' Ball
Daily Life of a Bored Archdevil
Daily Life of Divine Lord
Daily Life of Divine Overlord
Daily life of reincarnated goblin
Dainatian Chroniclesm *Hiatus*
Dakila
Damn! I just want to ask her out!
Damn it, Maria!
Damon's Rache
Dance of the Phaegon
Dancer may
Dangerous Detoxification
Danger Zone
Danny Styles and the Thunderdome
Dan's Shoppe of Oddities
Dante's Immortality
Dante the demon
Dantian: The Unforgettable
Dao Fang
Dao Fang( hiatus)
Dao is All-Encompassing
Dao of Emperor
Dao of Immortality - The Path of Crafting (Hiatus)
Dao of Repetition
Dao of Zenith Chronicles - Visionary Fantasy with Metaphysical Twists.
Darcy Sparrow and the Spectral Hound
Dare ga Oujo-Sama?... Boku?
Dargon
Dark advisor
Dark Apocalypse
Dark Ashes
Dark Avenger: Flames of Hatred
Dark Beginnings
Dark blood
Darkborn
Dark Bushido
Dark Chronicles
Dark devourer
Dark Dragon King
Dark Dungeon
Dark Dungeons of St Joseph
DARK EDEN: The Death God's Origin
Darkened
Darker than Black
Darkest Entity
Darkest Ground
Darkest Shadow
DarkForce: Conquest Expansion 1 (LitRPG Mini-Series)
Dark Gamer
Dark historiën
Dark Jokes
Darklands: Book Three of The Rhenwars Saga
Dark legacy of Ren Fen
DarkLight
Dark Light
Dark Lily
Dark Lord For Dummies?
Dark Lord of Tartarus
Dark Lord Saga (Original)
Dark Mage: The Offer
Dark Memories: Rebirth
Dark Memories: Revival
Dark Messiah : The Cleansing
Dark Mind
Darkness Devour [PAUSED]
Darkness God Shura
Darkness in the Heavens (Hiatus/Dropped)
Darkness: My Bitter Enemy
Darkness Rising
Darkness, Silence And Really Bad Breath
Dark Night
Dark Paladin: The Beginning by Vasily Mahanenko
Dark prime
Dark Rain : Book 1 of The Aetherium Saga
Dark Remnant - Injustice
Dark Retainer
Dark secrets
Dark Shade Chronicle
Dark Sky and a New Start
Dark Souls
Dark Souls 4
Dark souls:Greg's Story!
Darks Rising
Darkstorm: Book One of The Rhenwars Saga Preview
Darkstory
Dark Thoughts
Dark Veil
DarkVoid: The God of Death
Darkwalker
Dark Weaver: First Apprentice
Dark Wizard's Case. LitRPG series
Dark World. LitRPG series: Transformation (Book 2)
Darkworlds : London
Data Dragon Danika
Data-less
Dating Trials of a Vampire Queen
Daughter of a Dark God
Dauntless Star
Dawn
Dawnbreak
Dawn Dead (HIATUS)
Dawnlands, A New Beginning
Dawn of Antiquity
Dawn of Darkness
Dawn of darkness(ABANDONED)
Dawn of Gaia Online
Dawn Of Magic
Dawn of Myth
Dawn of Pangea
Dawn of the Abyss: Reincarnation of the Smith
Dawn of the Abyss: Return of the Smith
Dawn of the Apocalypse
Dawn Of The Dragons
Dawn of the Eclipse [Foremerly Known as Soul-Bound]
Dawn of the Realms: Promised Daughter
Dawn Rises
Daybreak
DayDream
Daydreaming magic swordsman
Day in the life of a _______ (COMPLETED)
DCO- Dungeon Core Online
D-Days
Dead Copy, Isekai ni Shin no Shujinko
Dead Core
Dead Core book 1 - Raven
Dead Count Fifty
Dead Dragon's Combat Manual
Dead Earth Online
Dead Fantasy
Dead Fiction Still Here For My Own Cringe Worthy Moments
Dead Gods Tell No Tales (Working Title)
Dead in the Water: A Dungeon's Tale
Deadliest Sin, Greed
Deadly Warfare - The War Between Great Nations
Deadly Zero HP
Deadman
Dead Men (Duo-OC SI)
Dead Rising
Dead Soul
Dead Universe.
Dead World Online
DeadZone - Synthesis
Dealer of Roads
Dealing with a Certain Fox's Antics
Dealing with Demons
Deals & Destiny
Deal With The Devil
Dearest Online
Dear Journal
D. Eaters
Death Becomes Him: An Age of Steam and Sorcery Novel
Death Bringer
Death Contract
Death Count
Death Dealers By Wi1dBi11
Death Drive
Death Fantasy
Death God
Deathgod Chronicles
Death God's Adventure in Another World
Death God's Adventure in Another World [Dropped]
Death God's Another World Adventure
Death God's Descent (DROPPED)
Death God System
Death-Guard Rejects
Death Incarnate
Death Incarnate (Main Story Completed)
Death Is a Reality
Death is Just a New Oppertunity
Death Is Only The Beginning
Death is Pleasant
Death Knight
Deathlands
Death leads to Godhood
Deathless Jack: Soul Games
Death Lives
Deathly Sin: Devourer
Death Mark
Death? Not even once!
Death of a Wallflower.
Death of Humanity
Death's Companion
Death's Crown
Death's Disciple
Death's Door
Deaths Door Online
Death's Heir
Death's New Entertainment By Zed019
Death's Oracle
Death's RPG
Deathstars
Death Streaming
Deaths Usurper *Sorry Done*
Deathsworn
Death Theory
Death, the Savior
Death touch
Deathtouched
Deathwatch Team Fluff: A Warhammer 40k Story
D.E.C.C - Demonic Expeditionary Consortium Council
Deception
Decimating Gods and Demons
Decimation [ Apocalyptic Novel ]
Decimation Mortism
DECK: Annoying Dreams
Deck of Cards
Deck of Souls
Decoder;Deconstructor
Deep Ambrosia
DeepDive
Deeper Darker
Deepest Desire
Deep Sea Shark
Deep Space Combat School: Nexus
Defender of Lapu-Lapu City
Defiant: The Bewitched Demon Hunter
Defiant Will
Defying Fates: I devion
Defying Heavens
Defying The Heavens
Deicide
Deity of carnage - Keeper
Deity of carnage - Unholy Kingdom
Dekar as Worlds Traveler
Delete
Delete by Shunnedanon
Deleted
Delete please.
Deletion Cheat(Dropped/Hiatus?)
Delvers LLC
Demise of the Gods
Demiurge: The Creator
(DEMO) Colorless vol.1- Phantamoire Enigmata
Demon Artificer
Demon Bane
Demon Blood Chronicles: Emergence (Book 1)
Demon Bride
Demon Forever
Demon Gf
Demon Hero
Demon Hero Reaper Saviour
Demon Hunter Rolland
Demonhunter Zecruix
Demonic Arts
Demonic Deliverance
Demonic Dungeon
Demonic Fire Cultivation
Demonic Games
Demonic Inscriptor
Demonic Intervention
Demonic Souls of Nature
Demonify
Demon in a dream
Demon in the magical world
Demonization
Demon King 101
Demon King Or Immortal God
Demon King Reincarnated as the Hero's Child
Demon King's Downfall
Demon King's end (Inactive)
Demon Knight
DemonLord_Floof – A lack of common sense isekai
DemonLord_Floof - The lack of common sense continues
DemonLord_Floof – The lack of common sense continues
Demon Lord in Angel's clothing
Demon lords? Gods? In this Crazy World, I'll fight them all!
Demon Lord try to be Human
Demon of Metal
Demon of the Darkest Night
Demonology For Morons
Demon Prince Familiar
Demon Queen's Life
Demon Saga - Phoenix Dancer
Demon's Country Protector
Demon's Journey
Demons of Zenora
Demon's Sinistra
Demon's Sinistra - Arc 1
Dennis the Conqueror (Sword & Sorority Book 1), A Harem Lit Fantasy Novel
Denying fate : path of the dark paladin
Depth's of Enhancement
Derelict Beginning.
De rerum natura
Dergons
De Sanguine Noctis
Descend
Descendant of Dawn
Descendants: Mask of the Phantom
Descendants of the Divine
Descent Into Entropy
Descent of Supreme Void God
Descent of the Strongest God
Desert Conquerer
Desert Odyssey
Desert Wanderer
Designation: M4R10N3TT3
Design of Hope
Desire
desired ERROR
Desire Dystopia
Desires Of Man
Desolated World
Desolate Stars
Desperate Hope
Despite not Being a Hero, Saint, or Even a Demon King, I was Summoned
Despotic Heart
Destinatus
Destiny
Destiny?
Destiny Dice
Destiny Ignition Exceed
Destiny: Infernal
Destiny: Infernal [DISCONTINUED]
Destiny Monogatari: The Hidden Object S1
Destiny of the Clans
Destiny Online
Destiny Upheaval(TRIAL)
Destroying the storyline in Xianxia!
Destroy The Heavens!
Destroy your new life, repair it, destroy it again by doing crazy things while screaming YOLO!
Detergent ディタージェント
Deus Ex Alice Madness
Deus ex Aliis Mundi
Deus ex Machina
Deus Ex Machina [Dropped :'( ]
Devastation
Deviant
Devil
Devil Cultivator in a Ability User World (Hiatus/Slow Release)
Devil Cultivator in an Ability User World
Devil Inside
Devil of the Heavens
Devil Park Island
Devil Princess Reincarnation
Devil's Crown
Devil's Daughter
Devil's Doll Reincarnation
Devils Knight
Devils Out of Inkwell
Devil summoner: Emotion
Devious Dungeon
Devoid of Luck
Devotion Of An Immortal
Devour
Devourer
Devourer of All (Blood of the Ruler)
Devourer of Destiny
Devourer (seint)
Devouring the Gods
Devour: Shiver Online
Devour The Cosmos
Devour the Stars (Blood of the Ruler)
Dex's Adventure Through The Elemental Nations (Completed)
Dexs/ Clairs Adventure
Dharmic Scripture
Diabolis
Diakazia: Laughter of Voiceless Slaves
Dial (Ben 10/MCU SI)
Diamonds of the Past
DiamonFTW's collection of OneShots
Diary Log of a Ghost
Diary of a Dungeon Master
Diary of an Insomniac
Diary of a reborn witch
Diary of Erica Kron
Diary of the Shadow Queen
Diasori Dynasty: The World's Last Heroes
Dias's Chronicles
Dice
Dice of Infinite Fates
Didactic Duplicate
Didalam Dunia Raja Iblis
Did I just ...?
Did I just become OP?
Died, but not dead.
Different Point of View.
Different World Along System One Punch Man
Different World along with One Piece System
Different World Reincarnation God Cheat Harem
Different Worlds
Different World with Save and Load: A Horror Story
Digging Holes
Digimon Empire
Digital Demons
Digital Haven
Digital Immigrant
Digital Magical Scientist
Digital Me
Digital Sorcery (A LITRPG Adventure Series)
Digitized
Dìle
Dilecto the happy skeleton
Dimensional Break
Dimensional Colleseum
Dimensional Convergence
Dimensional Exchange Program
Dimensional Intersection
Dimensional Rift
Dimensión Desconocida
Dimension Eaters
Dimension Extra
Dimension leapers
Dimension Mage
Dimensions
Dimensions intersection
Dimension Space - A Dungeon Core Novel
Dimension Traveler
D-INJECT Second Birthday
Dio, Rise to the top [working title]
Director, Machine, Paradox.
Dirge
Dirk, and the Black & Orange Catwomen of Betelgeuse VI
Dirty Secret
*DISALLOWED* The Light and Ages Saga: Reference Books
*DISAVOWED* DemonAge
*DISAVOWED* Descendants: Tales of Half Gods
*DISAVOWED* Fireheart: Age of Shadows
*DISAVOWED* Gemini
***DISAVOWED*** Legend of the Liquid Blade
*DISAVOWED* Masters of The Elements
***DISAVOWED*** Not A Princess Story
*DISAVOWED* The Machine Saga Vol. 1 Ral'mus
*DISAVOWED* Twilight of the Gods
Discarded Plotline (Discarded Monster)
Disciple of a Demon
Disciple of the Dark Arts
Disciple of the Evil God
Disciple of the Sword God
Disciples of The Strongest
Disconnected
Discontinued
(Discontinued)
(Discontinued) Aevitas - Not an NPC
[Discontinued] After the Fall
[Discontinued] Armus : First Draft
Discontinued-Harems Are Evil!!
Discontinued-I'm Not My Father Son!!
Discontinued-Legends of Vale Academy
Discontinued-The Fox With No Tails
DiscontinuedThe High School Gang Leader
Discontiuned-Troubled Cat
Dismissing Darkness
Distance Between Dimensions: Abandoned God
Distance Between Dimensions: Rise of the Summoners
Distant Leaps to Circinus
Dive
Dive Deep
Dive in the Afterdark
Divergent Cosmos
Diverge Summoning
Dive Sasquatch God!
Divine
Divine Arts
Divine Bladesmith
Divine Blood Celestial
Divine Change
Divine Diversions
Divine Dragon
Divine Dragon [Hiatus]
Divine Elementalist
Divine Empress of Chaos
Divine Entertainment
Divine Guardian
Divine Hell
Divine Hell (Sovereign Haast)
Divine Imperium - Warlord of Takamagahara
Divine Inheritance
Divine Intervention: Cataclysm
Divine Laws of Mind, Body, & Soul
Divine Locket
Divine locket of Hearts
Divine Pagoda Sect
Divine Painter
Divine Progress
Divine Salvation
Divine Selection
Divine Shopper
Divine Soul
Divine Souls
Divine Sparks
Divine Time Jewel
Divine Transformations.
Divine Void Emperor
Divinity
Divinity: Forsaken
Divinity Reforged
Divinity War - The Rise of the Gods
Djinn
Dk
Doc
Doctor in Immortal World
Doctor of Rebirth
Dodge Tank: A Crystal Shards Online LitRPG Novel
Do Dungeons Dream of Goblins?
Does it even matter?
Do I really have no skills?
Doll
Doll's Smile
Dolos, god of honesty
Domain
Domain of Man
Domain Warz
DomeNET Online
Domination
Domineering Frog King
Domini: An Uprising
Dominion
Dominion in the Cerulean Sky
Domus - Ignore the Cover Art
Don't Burst My Bubble
[Don't Die!]
Don't Do Hidden Quests
Don't Fear the Reaper
Don't Feed The Dark
Don't Kill The Magic
Dont Know How To Delete So Dropped
Don't label me!
Don't read this
Don't Stop Me Now
Don't Touch Me, You'll Die!
Don't Worry, We Have The Best Supporter On Our Team
Doomed Dungeon
Doomed To Be A God
Doomfall Alpha
Doomsday Pillars
(Do) Re:Mi
Dormant Beings (Tower of Eternity)
Dormir
Double Edge Hero
DOUBLE SYSTEM- Path to immortality
Doulou Dalu (Soul Land): The 8th Monster
Douluo Dalu - Hammer God Douluo
Douluo Dalu - The Legend of the Poison Emerald King
Downfall of the Champions
Downloaded
Down the Deep Blue Hole
Do You Dare to Dream?
Do You Ever Wonder How? How This Came To Be?
Draco by Flame
Draconia
Draconian System
Draconic Blood
Draconic Overlord
Dracula: Patient zero
Draegish's Light
Draegona Chronicles: Crystals of Andromeda
[DRAFT] Vradin
Dragged Into a Different World?!
Dragged to another world, I sought independence
Dragon?
Dragon Amongst Wolves
Dragon&Dragons
Dragon Arts
Dragon Ascension
Dragon Ball Alter: Rise of Little Green!
Dragon Ball, A True Coherent Fan-Fic
Dragon Ball Magic
Dragon Ball:RR
Dragon Ball: Saga Of The Strongest Human
Dragon Ball System
Dragon Ball: That Time I Got Reincarnated as Nappa
Dragon Ball: The RPG.
Dragon: Birth of an Ancient
DragonBorn
Dragon Cheat.
[Dragon child]
Dragon Child
Dragon Child of Thunder
Dragon Cross [Old Version]
Dragon Fairy
Dragonfall: Enchantment
Dragonfall: Soulborn
Dragon Fantasy
Dragonfather
Dragon Fist
Dragon Fragment
Dragon God
Dragon God Resurrection
Dragon Gods Bride ? I think you have the wrong soul ...
Dragon Guardian
Dragon Harem Bulletblade King - Strongest Story on RoyalRoadLegends!
Dragon Heart
Dragonheart - Dungeon Ritual
Dragon Heart. Stone Will. Book I. LitRPG wuxia series
Dragon Heart. Stone Will. LitRPG wuxia series
Dragonic By person
Dragon in another world
Dragon King *FINISHED*
Dragon Mage
Dragon Mastery: Daybreak
Dragon of Lightning
Dragon Princess
Dragon Princess Reborn
Dragon Rails: Renaissance
Dragon Rising
Dragon Road: How I Rise in My New Life
Dragonscale Online Book One: Gilded Dragon Slayer #6
Dragonscape Online [VRMMORPG]
Dragon Scythe Online
Dragon's Dagger
Dragon's Heart. Stone Will. Book I. LitRPG wuxia series
Dragon Sign: Gold & Glory
Dragon, Silver Dragon
Dragon, Silver Dragon; Revelations
Dragons Inheritance (HIATUS)
Dragon Skin
Dragon Slaying
Dragon souls
Dragon Sovereign
Dragon Spirit
Dragon's Regalia
Dragon's Rising
Dragon's Road
Dragon's Roar
Dragon's Soul
Dragon Stole My Cookie!!!
Dragon storm: Beginning.
Dragon Sword God
Dragon Throne
Dragon Town
Dragon Wars
Dragunov by YoYo
Drake
Dreaded Duke
Dreadnought: Seeking Freedom
Dream and Death are Synonyms
Dreambreaker
Dream; Catcher
Dream Chaser
Dream Connect(Stopped)
Dream Dungeon
Dream Engineer
Dream Game: Fighting for my Desires
Dreaming
Dream life!
Dream of Eternity
Dream of the Abyss (renamed)
Dream Online
Dreamscape
Dreamscape Beta
Dreamscape (Working Title)
Dreams Come True
Dream's Key
Dreams of a Forest
Dream's of Auore
Dreams of Dragons
Dreams of Sabers and Spirits
Dream to Dream
Dream Walkers Fight
Dream Weaver~ The Cursed & The Blessed ~~( Act. 1 )
Dream Weaver ~ The Cursed & The Blessed (Side Stories)
Dream Weaver~ The Cursed & The Blessed ~( Act.1, Act.2, Act.3 )
Dream Weaver ~ The LightBringer
Dream Weaver ~ World Liberation
DreamWorld
Dream World Online
Dream World Project
Drew Nance, Girl Detective Book 01: The Secret of the Old Clock
Drew's Story
Drezo Regalia
Drezo Regalia: Rebirth
Drift
Drifter
Drifting Clouds, Sheltered Storms (DROPPED)
Drip-Fed
Drive: Discovery Arc
Drive Time
Dropped
Dropped :(
(Dropped) - Gachapon
Dropped into a Xianxia World
[DROPPED] I threw away the legendary cat ears
(Dropped)The Ancient
[Dropped] The Eighth Child
[Dropped] The Former Cultivator Who Now Plays VRMMORPG's
(DROPPED) The Snake of the Fan
[Dropped] The Teacher and Disciple
[Dropped] Truck Driver Reincarnation
Drugs and Foxtails
Druid
Drunk Dungeon
Drunk Temptation
Drusus The Mighty
Dryad
Dryad Relife
D-Tripper
Dual Cultivation
Duality
Duality of a Soul
Dual Nature - A Harry Potter/Percy Jackson crossover
Dual Nature - A HP/PJ crossover
Dual Sword God
Duck and Wolf
Duel Anthology
Du Fyrn Vanyali
Dulled Mind
Dullest Adventure Ever
Dungeon
Dungeon Accident
Dungeon AI
Dungeon Alive
Dungeon and Stars
Dungeon Anfoesol
Dungeon Apocalypse
Dungeon Architect
Dungeonborn - Double Down
Dungeon Boss Player
Dungeon Builder
Dungeon Chef
Dungeon City Vanskoria
Dungeon Code
Dungeon Conqueror
Dungeon Conqueror [12+] (On Hiatus)
Dungeon core
Dungeon Core: Alex : Hiatuss Infinitetum
Dungeon Core/Realm Heart
Dungeon Crawler
Dungeon Creator
Dungeon Delve
Dungeon.exe
Dungeon Games
Dungeon Goblin
Dungeon God
Dungeon Heart
Dungeon in a xianxia
Dungeon Instinct
Dungeon Island
Dungeon Isolation
Dungeon Life
Dungeon Madness
Dungeon Mage
Dungeon maker out of the dungeon
Dungeon Maou
Dungeon Master in a New World
Dungeon Master Life In Another World!
Dungeon Mastery
Dungeon Misfits
Dungeon monster (dropped)
Dungeon Oasis
Dungeon of Apples? (Completed)
Dungeon of Destruction
Dungeon of Ideas
Dungeon of Immortals
Dungeon of Lights
Dungeon Of Mass Destruction
Dungeon of Night
Dungeon Of Storms
Dungeon of the Dark Wilds
Dungeon of the Dead.
Dungeon of The Deleterious
Dungeon of the Divine Goddess
Dungeon of the mindless
Dungeon of the Mountain
Dungeon Of the Void
Dungeon of Trees and Thunder
Dungeon of Yanabie Oasis
Dungeon Quest Online
Dungeon: reaching for her
Dungeon: Rise or Fall
Dungeon Robotics
Dungeon Runner
Dungeons & Demons
Dungeons & Monsters
Dungeons and Adventurers.
Dungeons and Dim Hallways
Dungeons are also creatures!
Dungeon's Ascension
Dungeon's Decsent (DROPPED)
Dungeon Sect
Dungeon Siege
Dungeon's Legacy
Dungeon Spirit
Dungeon Story
Dungeons. Why You Might Ask? Because I Can!
Dungeon System
Dungeon Tale
Dungeon Tales: Lands of the North
Dungeon Trope Story
Dungeon: (Unknown entry)
Dungeon Wars
Dungeon War: The Rise of Unknown Dungeon
Dungeon Without A Name
Dungeon World Creator Online
Dunrealm : The Chronicles of the Wanderer
Duology Dark
Duology: Light
Duolou dalu:another story
Durandel Online (DO)
Duskblade
Dusk God
Dusk of mythology.
Dusk of mythology. *Hiatus*
Dust
Dust to Dust
Dusty the Demon (On Hold, possibly indefinitely)
D.W
Dwarven Steel
Dying Dungeons: Dead Kings & Mad Queens.
Dying was harder than medical school until someone pushed me down the stairs.
Dynasty's Ghost
Dyson Approaches
Dysphoria
Dystopius
Each Determined Child
Eadenara Online
Earth 2.0
Earth 402
Earthen Beckoning
Earthen Journey
Earthen Lord
Earth First : Democratic State
Earth Moving Out
Earth Sage Doesn'T Want To Be Bothered
Earth's Core
Earth's First Dungeon
Earth's Hydra
Earth's Uprising
Earth Tactics Advance
Earth: The Gods' Playground
Earth to Rae
Earth Warriors
Earth XIV
Eat and Grow Strong (Old)
Eaten By A Slime?!
Eater
Eating Fast Is My "Overpowered" Ability
Eating Fast Is My Overpowered Ability
Eau de Toilette
Eburnean Passage
Eccentric Soul
Eccentric Soul - Rebirth Into a Fantasy World.
Echoes
Echoes (hiatus)
Echoes of Ruin
Echoes of the Cosmos
Echoes of the Mirror
E. Clipse(Slow Releases For Now)
Economicalopoly
Edea Chronicles: Hero Summoning Conspiracy
Edean World Online
Edelinferno
Edenawe by Rulpra
Eden Garter, Dragon Anomaly
Eden no Sekai
Edge of Eons
Edge of Magic
Edge of Reality (Phantom Server: Book #1) by Andrei Livadny
Educating E.T.
Efatra
Eidolon : Martial Familiar
Eight God Engine
Eijia
Ein Gard
Einherjar
Eir - The Immortal
El Aventurero Maldito
Elbards uppror (Swedish)(Dropped)
Elbard's Uproar(Dropped)
Elderia - Dawn of Creation
Elder Lich Saga
Elder Scrolls: Naruto
El Dorado
Eldritch
Eldritch Immortal
Eldritch Maiden
Eldritch Night
Eldritch Sorrow
Electronic Pulse
Electrosilver
Eleeah
Elemeninetic
Elemental Chrysanthemum Homeland Online
Elemental Duelist
EleMenTaLenT : A Dungeon Keeper's Tale
Elemental God
Elementalists
Elemental Monster Tamer
Elemental Nations: Oni from the Leaf
Elemental Ninjas
Elemental Online
Elemental Pheonix
Elementals: Crystal Garden
Elemental Soul
Elemental Sword
Elemental Swords
Elemental User in the world of one piece.
Elemental Warrior
Elemental World Chaos
Elementarem Vim
Elementia Online: Way of Aer
Elements of War- Fireborn: The Flames of War
Elements Saga
Element Zero
Elf War Online
Eliminator
Elitian XVI
Elizabeth, Elizabeth
Elk Road
Elm's Horizon
Elsa's Journey To The East
El Sexorcisto!
Elskria Online
Elswynd
Elten wars
Elten wars (Hiatus)
Elurias
Elurin's Tale: Extinguished
Elutheria: Adventures of a Recluse
Elven Blood
Elvendark
Elven Garden
Elycian
Elysium
Elysium: Diamond In The Rough
Ember
Embers
Embrace the Blade
Embrace the Blade [Dropped/Old]
Embrace the Ether
Embracing Death
Embracing the world with happiness!
Emerilia
Emily's Diary
Emotionless Pain
Empathic capacity of a teaspoon
Emperor
Emperor Magus
Emperor of All
Emperor of Blue Flower Mountain
Emperor Of Myraid Planes
Emperor Of Space and Time
Emperor of the Demon race
Emperor Of The End of Times
Emperor of the Era
Emperor of Yin and Yang
Emperor Saga
Emperor Saga : Slaves Covenant
Emperor's Ascent
Emperor's Journey
Emperors Path
Emperor's System
Emperor Tale
Emperor (皇帝)
Empire
Empire at War
Empire Building System
Empire Haven Online
Empire of Glass - The Heroic Legend of Heron
Empire of Souls
Emporium of Awesome
Empress of Blue Flower Mountain
Empress of the Lost Realm
Empress's Emprise
Empty as tomorrow
Empty Promises
Empty Promises [Hiatus]
Empyrean
Empyrean Ascent
Empyrean Blade Kira
Empyrean Ice Emperor
Empyrean Monarch
Emulation of chronology
Enable Evolution
Enchanted: Past, Present and Future
Enchant Gunner: Bullets and Magic
Enchanting
Enchantress: Pathways Through Darkness
Encroaching Darkness
EndGame Online
Endless
Endless cage(Dropped)
Endless Dungeon
Endless Expanse Online
Endless Fantasy
Endless Fight
Endless Horror
Endless Lands
Endless Online: Oblivion's Blade (LitRPG)
Endless Online: Oblivion's Promise (LitRPG)
Endless Online: Wildcards (Book 1)
Endless Planet Online(Haitus)
Endless Possibilities
Endless Prosperity
Endless Samsara, Limitless Nihility
Endless Time To Reach The Peak
Endless Universe
Endless Waltz
Endless Worlds
End of Civilization, First Emperor.
End of My Boring Life
End of Tales: life and death
End World
Energy
Energy Animals
Enganar
Enganar - The Watcher's Tale
Engineer Army
Engineering Civilization
Engine: Online
Engraver
Enjoying My Second Life in a Fantasy World
Enlarge
Enlightened Empire
Enor
EnRich
Enru: Accursed Child
Ensis Core
Enslaved Souls
Enterria
Enter the Storm
Enter the System
Enter The Warlock
Entferner
Enthralled: Book 1 - The Crystal Heart
Entity
Entity(dropped)
Ent of Pyromancy
Entries and Logs.
Entries of a Helper
Entropy
Entropy (Formerly: Who exactly Am I?)
Envy
Enyatta; Daughter of the Library
Eon
EOS (Element of Survival)
Eoum: The Tenth Summon
Ephemeral: A Journey of Souls
Ephemeral Cycle
Ephemeral Shards
Epic of Esloria
Epic of Necessity
Epilogue
Epiphany Online
Epoch
Epoch of Humanity
Equilibrium
Equilibrium (Crypto)
Era of Mutants
Ercse0
Erebus
Ered Kilmah, Overlord
Ereidien
Eretriah online. A LitRPG book.
Ero Dungeon Evolution
Ero Dungeon Evolution (RR Edition)
Eron
Eros Libera
[Eros] Swayamvar: Tamer Chronicles
Errand Boy
Errant(Original light novel)
Erroneous Quest
Erthen Chains
Escape
Escape from the Dungeon
Escape or Death
Escape the Room Game #1 - The Bedroom
Escaping the Box
Escapist
Esoteria: The Planes of Man
Esper
Esper In Magical World
Esper Online: The 15 Thrones
Esper: Search for Power
Esper the marauder
ESP Escapades
エッセンス (Essence)
Essence of the unRaveled
Esyr, the First Fae Dragon
Eternal
Eternal : Bloodborn
Eternal Bones
Eternal Champion Book 1: Divine Diversions.
Eternal Chronicles: Vampire
Eternal Conflict
Eternal Demon
Eternal Divinity
Eternal Dream
Eternal Freedom
Eternal Harvest
Eternal Horizon
Eternal Ice Mistress
Eternal Kingdom : A Gift From A Loving Brother in A VRMMO World
Eternal lord
Eternal Lullaby
Eternal Magneta
Eternal Pact *DROPPED*
Eternal Peace And Chaos
Eternal Pheonix
Eternal Plunderer
Eternal Regalia
Eternal Saga : Book One - The Beginning
Eternal Soul
Eternal Succession
Eternal Teacher
Eternal Wind
Eterna's Source
Eternia Rising : Lost
Eternity
Eternity Online, a military sci-fi GameLit Fiction
Ether Collapse
Ethereal
Ethereal Heavens: Genesis
Ethereal Reality
Ethereal's 13 Worlds
Ethereal Sovereign
Ethereal Space
Ethereal World
Etherial Gates
Et Non Lucem
Etryria [discontinued]
Ett Tu Tre
Eulalia's Adventure
Euphoria
Euterpe Online
Evenfall
Even if the World is Against Me
Evening Shadows
Even in the afterlife, I still hate mondays ...
Even the heavens will shudder
Event Horizon
Event Horizon (S5)
Evera: Mourner's Isle
EVERFIRE Online
Everlasting Soul
Everlasting Struggle
EverLast(Stopped)
EverSense...Offline?
Everworld
Everybody Loves Large Chests
Everyday Life As A Prison Guard
Everyday Life of a Otherworlder
Every Hero's Thorn
Every Hero's Thorn (Hiatus)
Everyone Else is a Fantasy Character
Everyone is my friend
Everyone Loves Fluffy Tails
Everyone's World
Everyone thinks I'm an NPC
Everything's Price
Everywhere & Nowhere
Eve to Eternal
Evil Dragon Against the Heaven Online
Evil God Mafia
Evil God Slayer - Vampire Lord
Evil Incarnate
EvilLive
Evil Overlord?
Evo
Evocatus
Evo-Gaming
Evolution
Evolution Arts
Evolutionary Slime (Dropped)
Evolution- From the Bottom to the Top
Evolution-From the Bottom to the Top
Evolutionist
Evolution of a Ball of Light
Evolution of a Cultivation Beast
Evolution of the Lazy Gamer by Bruticus
Evo:lution online
Evolution-revolution ! ( On Hiatus.... I will never give up... just need time. )
Evolution. Starting point: Worm
Evolution System
Evolution System+Customisation System=Stronger System? Maybe not though...
Evolve
Evolve and Adapt
Evolved
Evolved: The Apocalypse of White Light
Evolve or DIE !!
Ewan story
Exalted Immortal Emperor
Exceptional Normalcy (A Pokemon Fanfiction)
Excitement Turned Real
Excursion
Excursion Book 1, The Goblin Curse. First arc.
Executioner
EX: Emblem
Exgainer (Dropped)
Exhuman
Exiled Humanity: Exsilium Imperialus
Exiled Nomads of the Galaxy
Exile Online
Exiles
Existence
Existence of The Irregular 2 - Reincarnation
Exitium (dropped)
Ex Machina (Hiatus)
Exodus™ Online by B4DDI3Z
Exodus: The Assassin's Path
Exosolar
Exousia
Expanse
Experia Online
Experiment
Experimental Dungeon Novel
Experimental human in the new world
Experimental Omnipotence
Experimental Wuxia Novel
Exploit
Explore, Search, Hunt
Exponential Mana Regeneration
Expressionless?
Extant Expanse
Exterminator Dungeon
Extinction
Extracurriculars: Fantasy Meeting You All Here
Extra Life Online
Extrasensory Perception System (EsPers)
Extreme Sports!!
Eye from the sky: The Journey of Thaim
Eye of Adventure
Eyes Full of Sins
Eyes of Infinity
Eyes of passion
Eyes of Time: New World
Fables: The Forgotten Legends
Fabula Tactici
Facade
Faceless Phantom
Faded Grey
Faded Hours
Faded World: The Island
Faerie Story
Faerwald - Rise Above
Faery Knight - A Mirai Suenaga Adventure
Failed Dungeon Inn
Failed Hero
Failed Suicide
Failed World
Fair Princess
Fairwind's Fortune
Fairy Tail: Fubuki
Fairy Tale of Demon Queen
Fairytale of Mine
Fairy Xia Yu Manual Pampering the Beautiful Harem
Fake it till you become Perfection itself
Falene Fantasy: The Undying
Falgreys
Falknir - Rising From Ashes
Fallacy of Fate
Fallen
Fallen Apostle
Fallen Celestial ~ Traveler Of Worlds
Fallen Crow
Fallen Divine Online
Fallen From Grace - Blood Beginnings - Book 1
Fallen from Heaven
Fallen from the Moon
Fallen God decides to live a little
Fallen Immortal
Fallen Lands
Fallen leaf
Fallen Lord: The Start of A Demon Lord Tale
Fallen Star
Fallen star - A Dragon's tale
Fall For Me
Fall From Grace.
Fall From Grace - The Prequel
Falling from Earth
Falling Grace
Falling into Crazy!
Falling into oblivion
Falling rain
Falling Star
Falling Star of Evolution
Fall of Man
Fallout: Project Osiris [Fallout]
Falnen
Familia: Ang simula
Familiar's Chronicles
Family of abnormalities
Family of Fiends
Fanfic Ideas
Fangs
Fang the Iron Chef
Fantasia
Fantasial Apocalypse
Fantasial Rise
fantasial rise [HIATUS]
Fantasia Online [VR Game]
Fantasia Saga - Book 1: Rise of monsters
Fantasia: The odyssey of magic
Fantasy Annihilation
Fantasy Collision
Fantasy Dead
Fantasy fugitives (Hiatus)
Fantasy Hitman
Fantasy In A Turtle's Shell.
Fantasy Inbound
Fantasy into Fallout
Fantasy Mecha Online
Fantasy Mecha Online (Cancelled)
Fantasy Online: Hyperborea
Fantasy Road Trip
Fantasy Royale
Fantasy Unbound
Fantasy Unlimited (Dropped)
Fantasy wishes
Fantasy world Domination
Faonus
Faraday [Worm]
Far Behind
Farblade
Far from lost
Farmer's Dungeon
Farmland Saga
Farm Life
Farseer
Far Strider
Fast Food in Another World
Fatal Chapters: A Guide to Piloting Gods
Fatal Cries
Fatal System
Fat Boy Hero
Fate: A Short Story
Fateburn: Chaos uploaded(ABANDONED)
Fate Cannot Bind Me
Fate CON-trol
Fated Encounter
Fated Realms: A Tale of Two Siblings (Working Title)
Fate Epsilon
Fate/Negative
Fate Overcharge (Stalled)
Fate/Regalia
Fate/Resurrection
Fate's Assassin *dropped*
Fate's Choice (ABANDONED)
Fate's Fortune
Fate's Slave
Fate/Survivor
Father
Father at 15
Father of Monsters
Fayde of the Void (OLD VERSION)
Fayde of the Void: The Immortal King
Fayte
Fear: Ever-Changing and Evolving
Fearless
Fear Rune - The Abandoned Realms
Fear system
Fear the Netherlands
Feirut's One-shots
Fei's prophecy
Felicia's Second Life
Fell Deeds
Fell down into a dungeon
Female Immortal's Return to Earth
Femalekind
Female mage, a Baker, and a kingdom
Female Martial Empress
Feminist reincarnated in a fantasy world
Femme Fatale - An Element On the Run
FeralHeart
Feral Shadows
Feral: The Story of a Half Orc
FFO - Free Frontier Online
Fiction
Fiddler in Another World
Fidget Spinner Cultivator
Field of blood
Fiend Master
Fifth Dimension
Fifth Life: Scarlett
"Fight!"
Fighting Back The Tide
Fighting fate
Fighting for the Lord of Earth
Fighting God
File's Cor
Filth
Final Boss
Final Destiny Online
Final Earth
Final Hour
Finally a competent lord
Final Monarch
Final Rebellion
Finding Destiny
Finding Home: The Quest for Knowledge
Fingertips
Finley- The Lost Prince
Firakha - Of Monsters And Gods
Fire and Shadows. Legend of the breaker.
Fire Breather
Firechaser
Fire Emblem: Blazing Sword
Fire in the Blood
Fire Lord Seti
Firestorm Monkey
Fire within
First
First Academy
[First Draft, Moved] Of Astral and Umbral
First Light
First Of My Kind
First RE:Guards
First Vampire
First Waves
Fishing Priest
Five Elements Academy: A Tale Of Magic
Five Pointed Star
Five souls, 1 body
Five Squared
Fjorgyn: A Rebel Rises (Complete)
F**k Me! Hate Me!
Flags of Rebellion
Flame-Eyed Immortal
Flames of Divinity
Flames Within the Heart
Flaming Light
Flaming Phoenix
Flashback: Siren Song
Flash Step
Flavour
Flawsome
Fleeting Flight
Flesh and Metal
FLESH: Distorted Soul
Fletch!
Flightless Phoenix
Flight of Icarus
Flight of the Princess Sage
Floraling Secret
Floriena: The Start of a Journey
Flow
Flower in Ice
Flowers Bloom from Battlefield
Flowers change
Flowers on a Broken Path
Fluffy Tails and Horned Heads
Flute Immortal
Fly in Fantasy
Flying City of Lavender : Search for the Humanity
Fly With Us
Fodder
Fog of War
Followers of The Way
Follow the Reaper
Food Revolution in the other world
Fools of Fate
Fool's paradise (dungeon novel)
For An Eternity
Forbidden seduction
Forced into a vr world
Forced to be The Villains
Forced To Join Army And Fight Dragons And Demons!
Force Magician in Another World
Force of Nature
Forcer By maskdragon
Foreigner, Journey in a different Kosmos
Forest
Forest & Human Translator
Forestborn
Forest Born
Forest Dweller
Forest of puns (short story)
Forest of Teeth
Foreststorm
Forever
Forever Alone: Trinity Blade Online
Forever Online - Wanderer
ForeverQuest Online
Foreworlds: A LitRPG story
Forged in Fear and Fury - An Apocalyptic LitRPG
Forge of Destiny
Forge of Heroes and Legends
Forget Her Not
Forge Your Destiny
Forging a Digital History
Forging his own destiny
Forgive me, I didn't mean to take that!
For Glory
Forgotten Conqueror
Forgotten Emperor
Forgotten Memories
Forgotten Reincarnation in another world
For Grass and Glory
For I will…
For Justice
For Justice! - A Tale Of Paladins And Hammers
Fork This Life!
Former Demon Lord's Travels
Former Ice Princess
For Perverts Only
Forsaken
Forsaken and Forgotten Son
Forsaken Blood
Forsakendeva
Forsaken Hope
Forsaken Realms
Forsaken Soul
Forsaken Talents: A Dark Path
Forsaken Warrior - A LitRPG Adventure
Forsaken World
Forsaking Reality
Fort Geranium
For the Man who had Everything
For There is Will
Fortress Seven
Fortuitous Mage
For Verania!
Forward is The Day
For whatever reason, I seem to have reincarnated.
Founding Eden
Founding of Humanity - Animalist
Fountellion in The Spiral (kindle) - The Nature of the Game & Progression One
Fountellion in The Spiral - Progression One
Fountellion Sessions in The Spiral
Four Rhytm Across The Blue DJ - Fly For Once More
Four times I've died, the fifth was intentional
Fox girl in another world
Fox Goddess
Fox of the Shadows
Foxxy girl in another world
Fractured Stars
Fractures: A City Asunder
Fragged
Fragility
Fragmented Reality
Fragments Of Aeon
Frau NoSur
Frays in the Weave
Free
Free: An Unbound Soul
Free Characters For Others
Freedom
Freedom Awaits
Freedom Online
Freedom : shadow of sins
Freedom Universe
Freedom: Virtual Reality Evolved - (Codename: Freedom Trilogy)
Free Empire Online
Free Fanfic ideas
Free Flight
Freelance Saga
Freemen of the West!
Freestyle [DROPPED]
Free World Online
Fresh Blood
Freude (Hellsing Ultimate/RWBY)
Friend?
Friendly Neighborhood Necromancer
Frog bug kingdom
From a Neet, To The Emperor's Wife, To.....Eh, The Demon Overlord?!
From an Endless Time and a Countless distance
From a phoenix to a dragon
From a World of Fantasy to a VMMORPG
From Bards and Poets
From Beast to Man and Back Again
From Boy to Man
From Chief to the Emperor
From cripple to hero!
From Cultivation to Magic
From Death I am Reborn: Chaos will Follow
From Dreams to Magic
From Dreams To Reality
From Dust
From Fire: Birth
From FPS Game to Another World
From God to goblin
From One War, To Another
From Paladin to Pawn [HIATUS]
From RPG-like World to a Xianxia World.
From The Black (dropped)
From the Final World
From the ground up
From The Womb Of The Either
From Winter's Ashes
Frontier Crisis
Frontrunners
Front Tide
Frost Dragon Cultivation
Frost Iron Forge
Frozen Ascension
Frozen in time
Frozen Journey
Frozen Liquid
Frozen Soul (Completed)
Frustrated godly gaming
Fujoshi love story
Fun and magic
Fun in Other Worlds
Fun With Abduction
Furia Encarnada
Further Than The Sky
Fury
Fury: Book One of the Titanomachy
Fused Power
Fusion
Future Magic
Fuuko: The Fox-Masked Hero
Gabriel "The Bastard Son"
Gachapon!
Gachapon! Re:mastered
Gacha System
Gaia Awakens
Gaia Campaigner
Gaia- Legend of CC
Gaia's Garden
Gaia's Shield
Gaia's will and challenge
Gainers: The chronicles of The Nexus
Galactic Fist of Legend
Galactic Games
Galactic Internet: System Initializing Book 1
Galactic Showdown!
Galactic Waltz
Galal: Horde Master
Galataea Crystallim: Chronicles of the Lonely World
Galataea Crystallim: Redux
Galaxia: A Modern Fantasy! [DROPPED]
Galbadia Prime Online
Gallanor (On hiatus)
Gambits
Gambled World
Gambler's Fallacy
Gambling warrior
Game Change
Game Changer - Day Dreams
Game Cheater Reincarnated
(Game + Divinity) - Heroics = Our Reality
Gamed:Last Attempt
Gamed (Re : Cycle)
Game Makers
Gamemaster
Gamemaster's Adventures in another world
Game Master - Unlocked (Terror Infinity)
Game of apocalypse
Game Of Cards
Game of Death Gods
Game of Edge
Game of Hell
Game of Reality
Game Of Souls
Game of the Mad God
Game of the six
Game On
Game On!
Game... Over?
GAME OVER a daily life of a video game boss
Game Over. New Game.
Game Over: Rise of the Gods
Game Piece
Gamer
Gamer Girl
Gamer Kind
Gamer of the Dead
Gamer of the Dead (Europe Edition)
Gamer of the Martial World
Game, Set, Match
Games of Galdric
Game systems abilities in a fantasy world
Gameworld
GameWorld: Earth's Apocalypse
Game world or A different world?
Gaming God
Gaming Paragon
Gaming The System
Gaming the Tower
Ganda'lfr – The Left Hand of God
Gantzer
Gardener
Gardener of Immortality
Garden of Ark
Garden of Ash
Garth Online
Gast Academy: The Viridian Vipers
Gate Guardian - Song of the Frozen Soul
Gate Guardian - Tale of the Blazing Heart
Gatekeeper
Gate keeper
Gatekeeper of Death
Gate of Spirits
Gates of the Gamer
Gate to Utopia
Gateway to Nexus (Dropped)
Gears Of Rust (Abandoned)
G.E.A.R - The Study Of Nanomana
Gecko
Gehenna (Dropped due to MY LAZINESS)
Gehenna's time ( Hiatus )
Gem Wars - The α crystal
GemZ: Chronicles of Le'Tayah
GENE Project: Path to Perfection
GENE Project: Road to Perfection
General's Call
Generals of the Apocalypse
General Wife of Dark Emperor: Slow Witted Miss/Droped/
Generation: Alpha
Generika 0Ffline
Genesis
Genesis Accord
Genesis: Journey of the Creator
GENESIS PRIME- New Beginning
Genius has an Infinite Capacity
Genjitsu no Kyoukai
Genjutsu Made Real
Geomancer
George Brown and the Uth Stones by Duane L. Ostler
George of the Dungeon
Geo's travels through an unfamiliar continent
[German] RE:HUNDERT -Leben in einer anderen Welt-
Getting a Common Game Ability on Normal Life [Revised]
Getting Hard
Getting power IRL is expensive
GG Newb- A LitRPG Saga ($200 in prizes! Naming contest!)
Ghost alchamist's sinister witch [dropped]
Ghost Girl, Ghost Girl. She Gonna Take Your Soul!
Ghost Gods - Harem Book
Ghost of Versailles By Moridin
Ghosts in the Glass-- A Lesser Dark: Book II (Complete)
Ghosts Over the Forest
Ghoulish insanity
Ghoul Rising by(Tailspindark)
Gifted
Gift of Mercy
Gifts From Morpheus
GIG: God In Gold
Gi: Imera
Give me a word I'll make a world
Glass Cannon
Glass Cannons
Glass Cannon - the Search for Synergies
Gleaners' Guild
Glimmer, A Throne of Souls (An RPG Gamelit Novel)
Glitch
Gloria Infidelis -Glory Beyond the Madness-
Glorius Adventure Online
Glory Hole Adventure
Gloryhound - The Story of a Wizard's Assistant
Glory Of The Hunt
Gluttonous little crow
Gluttonous Prince
Glyph
Goal of a Cultivating Beauty
Gobbo
Goblin
Goblin Conqueror
Goblin Flood
Goblin Kingdom
Goblin Lord
Goblin Musicians
Goblin Progenitor
Goblin Rebirth
Goblin Rising
Goblin: Tower of Gates LitRPG Book One
God Among Men
God and demon
God Blade
God Blade (Hiatus)
God Chef Rordon Gamsay
God Complex
Goddess of Beauty
Goddess of Crystal
Goddess of Death
Goddess of the Sun and Moon
Goddess Tears
god Dimension
God Dragon Emperor
Godefiance: Audun
Godfall: The Lost and the Damned
Godfrey the Legend
Godhood
Godhood: Info Dumps
God in Deep
God Is A Game Designer
God Killed Me
God-killer
Godless
Godlike
Godlike Reborn
Godlings
God looking for love
Godly reincarnation
Godly System
God of All Element
God of all system
God of Battle
God of Chaos
God Of Cheat
God of Crows
God Of Disaster
God of Evolution
God of Exemplum
God of Heroes [GoH]
God of Infinity
God of Magic & Martial Arts
God of Magic and Creation
God of Mischief
God of Music
God of Nature´s curse
God of Plants
God of Sacrifice
God Of System
God of the Apocalypse
God of the Apocalyptic World
God Of The Arts Book 1: Captive of Alberdos
God of The Criminal's world
God Of The New World
God of World Creation
God Particles
God Project : Blank Slate
Godpunk: A Tale of Swords, Sorcery, and the No-Good Journalist Who Saw It All
Godric Levi Moria
Godric Magni
God's Adventure
Gods and Creators
Gods and Men: A litRPG Adventure
Gods and Worlds
Gods Are Watching
God's Beta Tester
Gods Be Wary
Gods Conqueror
God's Death
God's Descent
God's Design
God's Diary
God's Domain
Gods Domain
God's domain (bodyrefiner99)
"God's" Door
God-Sent Anathema
God's Eye
God's Fall
Godsfall (Ash Drake Series)
God's Fall Chronicles: Schism
God's fiction (CANCELLED)
God'S For Hire
Gods Game
Gods' Game
God's Game : Player [72]
God´s Games
God's game: Those at the apex
G.O.D.S - Great Overlords Dominating Stuff
God's Island
God's Journey To Be The Best Craftsman
Godslayer
Godslayer (Krndark)
God Slayer (Vol.1 and Vol.2)
God's Little Joke
God's Orphan
Gods, please help me. I don't want to die!
God's System
God, Stop that! Chaos Happened When She Became a He. [Dropped, Has no intention on continuing. The author got job]
God's Trial
God's Trials
God's Whims
God/'/S Will
God's wrath
God Vessel Online
God Yuje
Going Against The Ordinary
Goku And Saitama'S Ability With Demonic System In Different World
Golden Age
Golden Draconian
Golden Dragon's Ascension
Golden Horde
Golem core
Golem Soul (CANCELLED)
Goodbye, General
Good Demon's War
Good Evil
Good Game
Good or Bad. What's the difference?
Gotta Gacha
Governor
Grahlgar the Ogre
Grand Adventure
Grand Design
Grand Dream Online
Grand Fantasia Gates - He who Bled
Grand Magus
Grandma, let's form a party!
GrandMaster Dao
Grand Paladin
Grandsmith - Art of Forging
Grand Summoner
Grand Weaver: Renewal
Granny God-mode
Grantale Online
Graphomurk
Grasping Destiny (Temporary Hiatus)
Grasping for the Heavens
Gravecrawlers
Grave of Heroes
Grave of the Goddess
Graves
Gravestone (Dropped)
Gravitas
Gray Color HoC
Gray's Crucible
Great Ascension to Godhood
Great Dragon Emperor
Greatest Alchemist
Greatest Gamer (Dropped)
Greatest God Li Ma
Greatest Superhero
Greatest Xianxia Book
Great interdimensional war
Great Master of All
Great sin
Great Tyrannical Deity
Great War of Cheater! Another World Strategic Warfare
Greed
Greenblood
Green Mountain
Greenskin
Green Sky
Green Tea Sea
Greg Veder vs The World
Greyblood
Greyblood: Adventurer Academy (A LitRPG Series)
Grey Eyes
Grey [HIATUS]
Greyskin
Grey Worlds
Grimdark Ash: Twisted Fantasy
Grim Ether
Grimm
Grimmblood Volume 1.
Grimm Lord
Grimm, The Mythical Detective
Grimoire Bound
Grimoire Of OppaiMan
Grimoire: Retake
Grimstone
G.R.I.M - This Grim Game Of Ours
G.R.I.M - This Grim Journey Of Ours
Grinding in Vast Martial World
Grinding Levels on Ossunica
Grinding to Become a Protagonist
Grin the Cheat
Gris Evighet
Grissla the Witch
Growing Puppets
Growing Strong
Grudginer Tales by the WorldsTreeCommittee
G.R.U.U.U.L
>Cybermanteom: Choose your own LitRPG Text Adventure!
Guardian
[Guardian]
Guardian Heroes
Guardian Of Nature
Guardian of the Oracle
Guardian of the World
Guardian of Wicked Sphere
Guardian Online
Guardian Reincarnation
Guardians Awakened
Guardians of Midgard: The Legend Begins
Guardians Of The Helm
Guardians of Times to be
Guardians Will Fall, Heroes Will Rise
Guiding the Way
Guild App
Guilty
Gunbreaker
Gun Elf
G.Universe
Gun Meister Online 2
Gun Meister Online [First Draft Complete]
Gunrunner
Gunslinger's Code
Gun X Princess
Gun x Waifu
Gura Gura no mi Cultivator
Gur-dun: Grey's Selection.
Guthix, The Devourer
Gwyn's Pet Life
Hades XII
Häerandar the elf who is searching for a better life
Hail Storm
Hail The Emperor
Hail the King
Hai! My name is Satan!
Half A God
Half a Step Away from Love
Half-Blind Master(temporary title)
Half Demon, half human.
Half Dragon
H A L F L I F E
Halfway to Home
Haliel's Adventure
Hall of the Immortals
Hallowdash
Hallowed
Halloweenish Project Time Lapse
Halloween Specials
Halo: Spartan-021
Hammer of Order
Handyman
Hanging on Bones
Hanging out with the Mutants
HANNIBAL: Season 4 (Book Continuation)
Happiness!
Happiness, Sadness, and Anger
Happy Christmas!!!
Happy Dragon
Happy Ending
Happy Fantasy World
Happy Happy Fun Time
Harbinger [18+]
Harbinger of the Damned
Hardcore Online
Hardcore OP-ness
Hardcore: Qi Worlds
Hardmode
Harem In Another World
Harem infinity
Harem King
Harem Reaper
Harems Are Evil!!-REVAMPED
Harems are only for wimpy guys?
Harmony
Harmony: An Assassins Tale
Harry Gamer (Revamp)
Harry Potter: and the Book Dweller
Harry Potter And The Immortal
Harry Potter and the Insert of the Self
Harry Potter - Book 1 - Arrival To The Harry Potter World As a Villain!
Harry Potter - Book 1 - Arrival To The Harry Potter World As a Villan!
Harry's New Hobby
Harry-Stu Gamer by Zed019
Harukaze 春風
Harukaze 春風 V2
Harvester Wolf
Harvest Factory ~ a Farmer Life
Hateful Sin
Hater
Hatred: The Journey of the Madman [Old]
Haunted
Haunted Treasure
Have I Become a Vampire?
Haven
Havenbrook [Editing]
HavenFall (Thousand Lands)
Haven in a Dangerous World
Haven seeker: Rogue one
Have Scythe, Will Travel
Having a Common Game Ability In Normal Life
Hayato the Chibi who became a Great Demon King
Hazard Frontier
Hazard Lands (Dropped)
Hazard Online
Hazard Online book 1 and 2
Headshot! - A Zombie litRPG novel
Heads Will Roll
Healers Path
HEAL: In Calamity, Terra & War
Hearkened when he was Young (A Roman SI)
Heart Cores have hobbies
Heartful
Heartless
Heart of a Dungeon
Heart Of A Servant
Heart of Borneo
Heart of Courage
Heart of Creation
Heart of fire
Heart of the Dungeon
Heart of the Earth
Heart of the Forest (Hiatus)
Heart of the World
Heaven and Hell
Heaven and Hell Online
Heaven Cry
Heavenly Blood Monarch
Heavenly Dao Of The Sword
Heavenly Darkness
Heavenly Domination
Heavenly Evolution
Heavenly Goddess
Heavenly Mage Shura
Heavenly Martial Harmony
Heavenly Sovereign
Heavenly Void Emperor
Heavenly Will
Heavenly Yang Emperor
Heaven Made Travelar
Heaven Realm
Heaven's Awakening
Heaven's Brush
Heaven's Conqueror
Heaven's Cry
Heaven's Daughter
Heaven Sealing Art
Heaven's Emergency Exit
Heaven's Flute
Heaven's Grip : Orcs of Iaoue
Heaven's Will
Heaven Trial
Heavenward on Golden Wings
Hedonistic Mage
Hegemon
Heidi's Son
Heidi vs The Free Nations(dropped)
Heinous - The tale of an unusual necromancer
Heinous - The tale of an unusual necromancer (dropped, read the new one instead)
Heirs of Creation- A Supernatural Fanfic
Heir to a Lost Sun
Heir to the Eternal Throne
Heir to the Throne
Helden's Keep
Held in the Quiet Night
Heleg en Eryn [ GERMAN / SINDARIN ]
Helena's Plane
Hellborne
Hell-Bound
Heller: New World
Hell Fighters
Hellhound
Hell Knight
Hello, You're Through To Hades, How Can I Help You Today?
Hell's Dungeon
Hells Pit
Hells pits
Hell to Pay (Blood for Soul #1)
Helmer's Theory: A Butterfly Effects
Help I'm a Pathfinder Commoner trapped in a Game world.
Hemophobia
Henchman
Heralding Fruits
Her Crusade
Her Destiny
HereAfter: Dragons Fall
HereAfter: Dragons Rising
Here's Our Princess, Take Care Of Her! (And Don't Get Killed By The Dragon)
Heretic King
Heretic: Unbound
Here We Go Again
Her Highness Only Wants To Train
Heritage
Her New World
Hero
Hero? Again? No Way
Hero aiming to be the next Demon Lord concurrent
Hero Chronicles:
Hero City
Heroes & Villains
Heroes and Ancients
Heroes' Burden
Heroes & Harmony
Heroes of Ghese
Heroes of Jorg
Heroes of the Collapsing World
Heroes Online : Against The Darkness
Heroes Online - Rosy Undead
Heroes Return
Hero for hire
Hero:Generation
Hero Hunter
Hero Hunter: A superhero litRPG
Hero Hustle
Hero Hustle: Volume 1- The Beginning of a Warriors Melody
Heroic Chronicles Volume 2: Dawn of the New Beginning
Heroic Necromancer
Heroics of an Overlord
Heroic World
Hero? I'm assassin, but that's the same right?
Hero In A Monster Academy
Hero? Nope I'm their child
Hero Of Demons (Hod)
Hero of Edea
Hero of Naught (Original edition)
Hero or Demon Lord?
Hero or Fool
Hero or Monster
Hero or Villain?
Hero's Ballad
Hero's breaking
Hero's Call
Hero's Gear Online
Heros Of 21st century !
Hero's Symphony
Hero Status: Revoked
Hero Status: Revoked - Rewrite
Hero's Trouble; How did i end up as Hero?
Hero summoning ?? NO... it's are free soldier summoning !! (Discontinue)
He's The One™
He Who Fought The Gods
He Who Have Sinned
He Who Sits on the Throne
He Who Slays by Stevenoth: Discontinued
Hey, Hero Killer!
[Hiatus] City Dungeon Abyss
(Hiatus) Dungeon Defender
[hiatus] Dungeon Run
[Hiatus] In my second life, I will continue being a virgin.
[Hiatus] Player: Level 0
Hidden
Hidden Adversary
Hidden Forge: Lucem Ac Tenebras
Hidden Forge: Lucem Ac Tenebras (Rewrite in Progress)
Hidden Throne
Hidden words
Hidden World
Hierohn
High Crew
High God
High Lord Calamity
High School DEATH GAMES
High school life in a world where everyone has superpowers
High School of Magic and Weaponry
Highschool Sweethearts
High School with Humans
High Skies Piracy
Hightailing It
Highway Crooks
Hi,I'm Everything.
Hiiro's adventure
Hikari Okami: Kitsune Series
Hilarity of a Game-Breaking Player [Hiatus]
Him and Her - An Odd(?) Story
Him? Her? I am Two, But Two am I [HIATUS/DROPPED]
Hindsight
Hiraeth, longing for a home that never was
Hiro's Journey
Hiro's Tale
His Android Wife
History of the Orcs According to, The Beginning: Breath Of War
History Repeats
His Whispers
Hit!
Hit It Very Hard
Hit The Road, Jack!
Hive - Locked Up In Space
Hive Mind
Hive Queen
HofN original
Hold the line.
Hollowed Out
Hollow Heart Journal
Hollowing Embers
Hollow Moon
Hollow of Holy Hole
Holocaust Of Saturn
Holy Emperor Satan
Homecoming | A Chronicles of Ascension Story
Home Turf
Homeward Bound
Homunculus Queen
Honor of the battlefield
Hooked Up: A Magical Monk LitRPG Adventure
HOPE Engine
Hope in the Dead - Alone (For you Zombie Lovers)
Hope in the Dead - Survive Alone (Zombies)
Horizon Dawn
Horrific
Horror from the Depths
Horsey Ashes
Horvat's World
Host, At Least Let the Villains Act First!!
Host Me!
Hot Guy Cold Guy
Hound of Ériu
Hound of War
House Cazador: Kingdom of the Lion
House Denholm's Madman: Raising the Demoness in My Head
House Of Crossroads
House Of Omen: The Indomitable Smithersmith
House of Omen: The Sheriff Of Langerhans
House of the Dead
House of Wolves
How a Carpenter became the strongest melee fighter of the New World
How a lame loner's life is not like normal dudes
How Deep Can People Fall?
How Does One Become Strong?
How do you kidnap a whole school of kids to another world?!!
How Do You QA Test a Tsundere Android!?
How Everything Started
How I became a monster
How I Destroyed The Main Questline At My New Job
How I escaped being a hero
How infinite is infinity?
How I Rule The World
Howling
Howling Blades
Howling Blades (Formerly known as: Dying was harder than medical school until...)
Howling Thunder
How my lust for a dungeon boss lead to a life changing experience
How (Not) to Conquer the World!
How NOT to Run Away From Life
How Strange, I Seem To Be...
How The Weak Live
How to Avoid Death on a Daily Basis
How to be a Good Evil Overlord
How to become a Demon Lord
How to become an evil overlord!
How to:Become an Evil Overlord
How to Become a Wizard
How to Break an Evil Curse
How to Date an Android
How to Fake Your Own Death (Dropped)
How to Fix a Moronic Incel
How to Get A Girlfriend... and other Adventures!
How to get lost: a wanderers guide
How to God 101
How To Go To Another World Manual
How to have fun in an apocalypse
How to Kidnap your Princess
How To Kill Boredom (And The Gods)
HOW TO…(now complete with a 'Run Away From Your Death Flags' version!)
How to protect a hero
How to Survive a Summoning 101
How To Tame Your Princess
HS Dungeon Crawl
Hui Lin: Speechlessly Cultivating
Humanity
Humanity's Hell
Humanity's last hope
Human Outside, Demon Inside
Human Soul
Human To Fish
Human: Tower of Gates Book Two
Hundred Worlds
Hunter, Adam Hunter. Electrician.
Hunter Markell
Hunters
Hunter's Blind [Working Title]
Hunter's Bond
Hunter's Knife
Hunters Of Reality
Hunters of the Night
Hunter : Surviving in the New World
Hunters World
Hunter X Hunter: Royalty and the World Beyond
Hunt for The killer with The Cursed Blade
Hush - The Sin of Man
Hybrid Summoner
Hydra
Hymn of Ignis
Hyperburst
H Y P E R S P A C E
Hyrim: A History
Hy'Ruh-Ha
Hysteria (hiatus?)
I am a Bug
I am a Fish.
I am a genius so I don't need a strong cheat to survive
I Am A God Tree?!
I am a Guardian in another world!?
I Am A Hero: I Believe I Can Fly
I am a Slime
I Am A Spaceship!
I am a tree
I Am Brand
I am but a humble Storyteller
I am but Divine
I Am Gamer
I Am Going To Die (In This Game-Like Dimension)
I AM Human or Devil
I am infamous
I am Just a Farmer
I Am Legend
I Am Malcolm Landgraab
I Am: Mud Dragon
I am My Own Disciple
I am Not A Hero
I am Ordinary
I Am Part Dragon (Part 1 Completed)
I Am Power
I am Prometheus
I am revived in the body of shanks in the Strange World
I am staff
I Am Supreme (Reloaded)
I am the Chosen One
I Am The Empress
I am the firstborn of a new world...
I Am the "God of Death", Whatever That Means.
I Am the "God of Death", Whatever That Means. (Revised)
I Am the Last
I am the supreme evils daughter
I am the Villian
I am Urist
I am Urist (Book 1 Done)
I am Urist (Book 2 Start)
I, a Water Snail, accompanying the Immortal Hero
I Became a Member of my Friend's Yandere Harem?!
I Became A MOBA Character
I Became A Vampire In Another World
I Became my Granddaughter Familiar!? (ReWrite)
I Bought Some Guy's Soul On eBay
I Came Back In Order To See You
I Came, I Ran
I came to the world to become a villain
I can cheat? So let's have fun.
I Can Hear Your Thoughts, but it's not like I'm Telling You or Anything!
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic Love-Comedy Light Novel
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic-Love Comedy Light Novel
I can't die but I want to live in excitement...(Dropped)
Icebound Immortal
Ice Cubes
Ice Queen By Wi1dBi11
Ice Soulist
I Come From The Water
I could be in a coma
Icy Vendetta
Idea Dump
Idea Exploration
Idea/Scene Compilation
Ideasthesia
I Decided to Write a Story
Identity
Identity Undefined
I did a good thing now What?
I didn't actually want to change ♂♀
I Didn't Even Want to Live, but God Forced me to Reincarnate
I Died
I Died And Got Reincarnated Into An Isekai World As An Elf With No Mana... But With An RPG System
I Died and Reincarnated as a Plant
I Died In my Old World and Now I'm THE First Male Valkyrie In Another World
.........I DIED!!!(might be changed)
I died, so I'm trying again with all my stat points put into my Artistry stat!
Idmon the Skeleton
Idol By Laulau20
Idol's Road
I don't care if it's an RPG world or not!
I don't want to be a hero
I Don't Want to be a Hero! But I will fight to Protect my City! (Hiatus)(Might restart soon updated: 2-19-2016)
I don't want to be the Hive Queen
I do whatever I please
I Enchanted The Whole Forest
I Fell And Thus I Must Rise Again.
If only...
If only common sense was a bit more common...
If you're lucky and you know it summon me... Three tissues. :)
I Get A System, But I'm Still On Earth.
IGNARIS RAY by swey
Igni Quantum Ultionis (DROPPED)
Ignite (The Fireborn Chronicles Book 1)
Ignition
Ignius
I got reincarnated and got a creation cheat
I Got Reincarnated as High Human with Creation Eye
I Got Transported To Dota World with Just 2 shared Tanggos and qualing blade?
I Guess I'm An Angel Now
I hate being wed in a fantasy world!
I Hate You Master
I Have Been Summoned as a Hero ...I Am a God Though
I have reach boundless infinity as a good for nothing. Now I want to restart in another world being the ultimate genius.
I have shanks body in a strange world
I have the Unique class of "Monster Factory"?[ DROPPED]
I Help My Friend Get Together with the Girl I Used to Like
I Just Fell Asleep and Somehow I'm on The Battleship?
I just had a realisation recently that I am surrounded by bishies and...
I Just Want To Eat 3 Meals a Day
I just want to play alone!
I Know I like Ships but Why did I reincarnate as a Aircraft Carrier?
I Know I like Ships but Why did I reincarnate as a Aircraft Carrier? *REWRITE*
I Know I like Ships but Why did I reincarnate as an Aircraft Carrier? *REWRITE*
I Live a Funny Life
I live in the dark world
I'll be happy as a monster
I'll get you back!...Sooner or later.
I'll Pay2Win in Another World!
I'll try this cultivation thing
Illuminated Azure Dragon
Illusion
Illusory
Ilm.Proxy Isekai
I love this world (Complete)
I'm a 70 years old mage not a little girl
I'm a crazy person who jumped in front of a truck to be reincarnated into another world -on purpose!
Imaginary World (The half world chronicles)
Imaginatio
Imagination Is Creation
Imaginator
Imagine Dragons
Imagining Online: The game
I'm a girl, but I like another girl?!
I'm a God?
~I'm a Good Boy~
I'm a hero? Nope, familiar
I'm a Kitsune?
I'm a Man!
I'm an NPC?
I'm A Professional Gamer, So How Did I Become King?
I'm A Snaaake
I'm A Superhero
I May Or May Not Have Caused the Apocalypse...? Tee hee~
I'm a zombie
ImBalence
I'm basically a slave with a far too nice master
I'm clueless in another world.
I Messed Up My Otherworldly Journey
Im Going To Another World Even Though Im Not Asian
I'm going to do it! I'm going to reincarnate into a fantasy world and live a great life!
I'm Gonna Be a Wizard When I Grow up Again!
I'm Guilty, My Beauty
I might be Overpowered
I'm in a different world....but I don't mind
Im in an otome game i know nothing about
I'Minas
I'm Just A Summoner
Immersion
Immersion: Reboot
Immoral Cultivator Trump: The Alternative Facts
Immortal
Immortal Ascension Tower
Immortal Ascension Tower (OLD)
Immortal Conqueror (dropped)
Immortal Demon
Immortal Dual Sword God
Immortal Dynasty (Rewrite)
Immortal Emperor
Immortal God of the Blade
Immortal in a Mysterious World(Cancelled)
Immortal in Another World
Immortalized
Immortal Ki Technique
Immortal Mage
Immortal Mage - or - How a Former Immortal Became an OP Mage and Conquered a LitRPG/GameLit World
Immortal Mage - or - How a Reincarnated Immortal Became an OP Mage and Conquered a LitRPG/GameLit World
Immortal Martial God
Immortal Necromancer
Immortal on Earth
Immortal Path
Immortal Rebirth
Immortal Shards(hiatus)
Immortal's Lament [Dropped]
Immortal's Musings: A Werewolf's Tale
Immortal Soul
Immortal Souls
Immortal Sovereign
Immortals: The Curse of Samsara
Immortal sword
Immortal Swordslinger
Immortal Twain Dance
Immortal Tyrant in Another World
Immortal War
Immortel Evolver Dungeon
I'm No Hero
I'm Not Going To Let You Capture Me!
I'm nothing special, so can i go back please ?
I'm Not the Demon Princess!
I'm Not The Dragon's Mom
I'm Not The Protagonist?
I'm on TDY from Hell
Imoogi
Impera
Imperator
Imperator of Beasts
Imperator Of Chronos
Impossible Devices
Imppossible
Impractical Magic
I'm pretending to be a girl in a MMORPG
Improper force
IMProvised combat
Impulsive - Descendants of the Gifted
Impulsive: Descendants of the Gifted
I'm Raising A Chuunibyou Dragon Girl?!
I'm... Skeleton A?!
I'm (Sort of) an Expert on Ghosts
I'M Supposed To Be The Hero, So Why Am I A Skeleton!?
I'm Sure It'll be Fine! ...right?
I'm the descendant of the Demon Lord!
I´m the Dog of a young Mageknight
I'm the Final Boss!?
Inada
In a different world with the Seven Deadly Sins system
In a diffirent world with One Piece system. cliche? No it's a cancer cliche
In A Distant Past
In a medieval world,Why i got a malus instead of a cheat?
In a modern world with a game system!!!
In A New Life
In a new world, so lets go it alone!
In another world as a sim
In Another World With My House
In A Parallel World With Random Skills, I Reluctantly Become A Mafia Boss?
Inara
In Association with Death
In a World of Magic
In between lives
Incanto Anima
Incarnation
Incarnation : Another Dimension
Incarnation Of The One
Incarnations of War
Inception of Cultivation
Incomparable - (Unparalleled)
Incompatible Universe Merge
Incomplete
Incrementum
Incubus
In Darkness
Indefinite
(Indefinitely paused) The Stone-hearted Enchanter
In different world with Assassin's creed system
Indigo
Indistinct Instinct
[Indonesian] Great world traveler
Indra of the Accursed Blood
Industrialising Dungeon: The Crimson Forges
I Need Time
I need to repair the gods of a world?!
Ineffable Events
Inertia
Inexorable Chaos
Infarite
Infected Life {ON HOLD}
Infernal Gems: Diamond
Inferno
Infested
Infigeas Online
Infinite Hiatus (completed)
Infinite Horizon
Infinite Horizons
Infinite Legend
Infinite Levels
Infinite Martial Way
Infinite Metropolis
Infinite: Monster
Infinite Ocean
Infinite Possibility
Infinite Quest: The Crazy Ice Wizard
Infinite Realms (Working title)
Infinite roams of wandering souls...
Infinite Thera
Infinite Wishes
Infinite Worlds
Infinity
Infinity Arcana
Infinity Hero
Infinity Loop
Infinity Online
Infinity Saga
Infinity Start
Infinity Summoner ~ Summoner Of All
Infinity Tomes - Legacy of the Ancients
Infracto Animo
Ingame
Ingame 2 Homeland
In-game Item Storekeeper
Inglorious Bastard
Inheritance
Inheritance Of A Hobo
Inheritor of the two dragons
Inheritors
Inhuman
Iniquity
Initializing the Code System
Ink Stained Eyes
In Love with Lightning
In Maple Halls
In Maple Halls, where Dwarves and Wizards Rest
In my Name as--
Inner Demon
Inner Light
In No Way...Is This My Fault....Right?
In order to create the Ultimate MC, I became Soldier A!?
In Our Image
In Our Last Moments
In process of a rewrite
In Pursuit of Glory
Inquisitor
Inquisitor: The Hunt
Insania Online
Insanity
Insanity Online! The Forging of A TRUE NORD
Insanity Paradox
Insatiable Hunger
Insectasaur
Insect Dungeon Vs The World
Insect Dungeon vs The World. (On Hiatus!)
Insectum Chronica
Insert Coin To Continue
Inside my Mind
Inside the Box
Insignia's Story
Inspector of God
In Spite of it All
Instant Supreme God
Instinct
Integrity and Solace: Divine Intervention
Interactive Dungeon
Interactive Evolution
Interactive tribe
Inter-dimensional House Travel
Inter Dimensional Time Travelers
Interdimensional Traveler
Intergalactic Convicts
Interlude
Interstellar World Struggle TV
Intervention
Interverse
Interview With the Hattoris
Interweaved Destiny
Interworld
In That Moment of Suffering
In the Aether
In the Another World with a Young Body
In The Beginning
In the City of Wisteria
In The Dragon Ball Universe With The Summoning System
In The Dragon Ball World with a System
In The End
In the End the Truth Remains
In the eyes of Infinity
In the Eyes of Others
In The Light Of Fire
In the modern world with a game system!!!
In the modern world with a game system!!! Reworking!!!
In the Naruto world
In the Naruto world (1)
In the Outskirts of Minazuki
In the Shadow of Heaven
In The Spiral: Connected Stories and Fragments from the Virtual Future
In The Tall Grass
Into a Strange World
Into the Abyss
Into the Black
Into the Inferno
Into The Light
Into the Maelstrom
Into the one-piece world
Into The Past.
Into the Rift: Akali
Into the Secret (name still needed)
Into the Secret of Tirlus
Into the Trenches
Into The Valley Of Gods
Into the Void ((Status: Dropped))
Into the World
Into the world of Hero Academy
Intricate Soul
Invent, Transform, Create and Destroy
Inverse Summoning
Invictus
Invictus: Memoirs of an otherworlder on a mission
Invictus Online
Invijible Panda
Invincible
Invincible Canadian Futa Goddess Cultivator
Invincible Canadian Hermaphrodite Goddess Cultivator
Invincible Canadian Hermphodite Goddess Cultivator
Invincible Earth!
Invincible in other world
Invincible War God
Invincible wizard at Fairy Tail
Invisible Blood
Invoker
I once was named Nguyen
I only want an ordinary life
Iraslyn
Ira Tenebris
I reached Godhood by mistake
I Reached Reincarnation Limbo Too Early
I Really Am An Internet Celebrity!
I reincarnated as a baby dragon king!
I Reincarnated as a God Working in a Shitty Sweepstakes Call Center
I Reincarnated as a Hero's Bad End
I reincarnated... As a human!
I Reincarnated as an Alien Monster
I Reincarnated as a Panda
I reincarnated into a bat
Irobu's Odyssey of Deceit
I.R.O.N
Iron Blood Overdrive (Hiatus)
Ironclad: Another world conquest with unbeatable technology
Ironside
Irrationality
Irregular
Irregular Awakening
Irregular Elementalist
Irregular Entity
Irregular (Rewritten)
Irregular's Rebellion
Irregular Wing
Irresponsible Former God of War Renox
Isekai Dudes On The Run
Isekai Gundam
Isekai Gundam (Dropped)
Isekai Gundam (Reboot)
Isekai kami desu ka? -- (God of another world is it?)
Isekai Speedrun
Isekai Strategy Game
I Shall Be Hero No More!
I Shall Eat Everything
I shall seek revenge
I Shall Stand Supreme
I Shall Steal the Heavens (我欲劫天)
I Shall Tame the World!
Is Heaven Supposed To Be Like This?! -Mature
I should have been the Hero instead
Is it Possible to Kill a Hero?
Is it Really Ok for a Dungeon Master to Manage a Dungeon?
Is it Reincarnation if I'm Still Dead?
Is It Wrong For A Spiritron Hacker To Pick Up Girls In A Dungeon?
Is It Wrong To Be A Mutant?
Is It Wrong to Try to Pick Up Girls When You're Disguising as a Girl?
I Slipped into Another World and Became this Demonic Guy's Pet
Isolated Dungeon: Breaking The Chains Of Fate
Isomeria
I sort of brought Armageddon, but on the bright side, I can go to school!
(ISSTH Contest) Misadventures of Lord Fifth
Is that a T-Rex outside my cave?
Is that a T-Rex outside my cave? (On Hiatus)
Is this really luck?
I Suck At Reincarnations
I Summoned Myself, EH?
I Summoned You
I Swear my Brother's the Protagonist of a BL Manga
Ithaca
I, the CEO have to Farm to Survive?
I, The Maou
I think i lost my head
I Think My Familiar is a DemonLord
I threw away the legendary cat ears
It Is a Slave
It's a Gamers world after all!
It seems I reincarnated into that world, time to avoid the death flags!
It's not a game
It's Only Another End of the World
It's raining goblins !? [Dropped]
It's the Healer's Life for Me
It's the Healslut's Life for Me
It That Laments
Ivan and the Black Riders
I've Been Summoned as a Hero ...I'm a God Though
I've reincarnated, but I'm a Girl! Wait, am I not even Human?
I've Reincarnated in another world as a cute fairy
Iverson's Pillar
I've Transmigrated... with a Broken System
I've waited my whole life for this THE Apocalypse
I wanna be a gamer!
I Want a Dragon Waifu!
I Want To Becoming A Great Summoner
I want to play this deadly game again.
I want to restart my world but still have my knowledge and a few cheats
I Was A Loner, But My Class Got Summoned To Another World And Now…
I Was a Teenage Necromancer
I was Bored So I Became The Antagonist In a VR Game
I was brought in another world as my catgirl avatar.
I Was Given A Second Chance, In a World of Fantasy?!
I was Once the Demon King!
I Was Randomly Thrown Into A Game Like World By A Stray Astroid
I was Reborn as a Background Character
I was reborn as a Cursed Swordman ?! [HIATUS]
I was reborn as a hybrid dinosaur in Another World
I was reborn in another world with a maxed out speech skill
I was reincarnated as a dungeon, that's good, but where are my cheats?!
I was reincarnated as a fox in a strange world
I was reincarnated as a Magic Academy!
I was reincarnated as a puddle of water...
I Was Reincarnated as Someone's Mana??
I was reincarnated into a fantasy world as a woman?!
I was reincarnated on the One piece World
I was summoned as a Dragon?!
I was summoned in another world
I was summoned to another world, but i'm a dog!
I was summoned to another world without any cheats so I became a villager
I was the pet rabbit of a young druid girl in my next life
~I was Transported to another world and became overpowered thanks to my cheat skill~
I who have Fallen
I will absolutely cultivate
I Will Always Be With You
I Will Be The Harem King!
I Will Burn Up My Kingdom And Disappear
I will create a kemono paradise!
I will Kill the Hero! With Fluff!
I Will Pave My Path With Blood
I Woke Up As A Girl?!
I Won't Kill Myself for the Second Time
Izar
Jack
Jack 21
Jack at World of Syntaria
Jack-of-All-Mages
Jack of the Devil's death forged body
Jack's Adventure
Jack, The Inter-Galactic Wizard
Jade by BlueShadow
Jade Fire
Jade Fire (Hiatus)
Jade Fire (Wuxia)
Jade General
Jade Immortal
Jadepunk
Jager: The death Angel
Jake and the Dynamo
Jane Doe Chronicles - The Case of the missing Imaginary Friend
January City (Project Lunation Book 2)
Jasmine
Jaune, The Strong
Jayson Agonistes: Breaking Hell !
Jellyfish
Jeweler
Jezoi
Ji Aleksy
Jimoel the Great and Powerful
Jim's World
Jin
Jinsei no Hineri
Jinsei no Hogo
Jintetsu
Jin The Talentless
J`nk: Refuse Refuge
Job Change
Jobless Knight
Joe in medieval fantasy world
Joe Stein: The adventures of a 'realistic' reincarnate
Joe– the chimpanzee cultivator
John
John Doe: A Nobody in Space.
Johnny's Bizarre Fidget Spinner
John Smith
John's new life
John the Average Knight: Marvellously Mundane
Joie de Vivre
Joker's Potpourri
Joker's way of life
Jokes On You
Jolt
Jonah Now Jasper
Joruney To The Starry Sky
Jotuun
Journal of a Falcon
Journal of poetry
Journals of Cultivation
Journal Teleport Science Something
Journey
Journey [Droppped]
Journey from Linchen
Journey In A New World
Journey into My New Life
Journeyman
Journey of 5, The birth of 1
Journey Of A Creator
Journey Of A Hawk
Journey of a Lifetime
Journey of a Mage
Journey of an Exceed
Journey of a Skeleton (undergoing rewrite on different account)
Journey Of A Stoner
Journey Of Destruction
Journey of Key (Updated)
Journey of the Black Rose
Journey of the cheerful assasin
Journey of the Time Mage
Journey: Rayder White.
Journey through the Worlds
Journey to Boundless Infinity
Journey to Elvander
Journey to Nowhere
Journey to Raise a Dodge-Debuff Scarecrow
Jovan's Gaze
Joyde's Yellow Book - Volume 2
Judgement
Judging The Creation
Judgment To Earth
Jumper
June
Junkland
Junkyard Magician
Jupiter's Rising
Juryokine
Juryokine: Exile of Heroes
Just a Guy in Space
Just Another General
Just Another Isekai Story
Just another RPG story
Just Another Story
Just Another VR Game Story
Just An Outlier
Just a passing goddess, don't mind me.
Just a random guy surviving Apocalypse litRPG
Just a random Zodiac Book in the Internet
Just a Rock[DROPPED]
Just a Simple Guy
Just A Simple Heist
Just a Teacher
Just a zombie trying to survive
Just Call me Yumi
Just For Fun
Just Luck
Just one more level
Just Useless Ideas for a Novel
Just your typical isekai story, or is it?
Just your usual summoning story
Juvena
Juvenile Gladiators
Kael Cor:A Vampire's Awakening
Kael - Rise of the Blood Mage
Kaels Adventure
Kage in another world
Kage no Kami
Kage System
Kail's Life of Adventure [dropped]
Kain's Adventures
Kain, the Caveman
Kairos
Kairos & the Snowdrifts
Kairos & the Snowdrifts (Edited)
Kaiser Jager The Mutagen Hunter
Kaizen
Kalestra's Chosen **On Hiatus**
Kali Yuga
Kamen Rider Tenshi: By Iccirrion
Kaminoa
Kami-Sama
Kana death god
Kanai's Alchemical Rock
[Kancolle] Diary of an Admiral
Kano's Necromantic Comedy
Karma and Reincarnation
Karma Online: Awakening
Karma's curse; the demon lord of wrath
Karma - The Game
Karn
Katra
Kaylee's Journey
Kazama wa Onnaline
Kazan - The Hero No One Wanted
Kaz the infinite one
Keeper of Steeds
Keeper's World
Keflar - A Tale of an Unusual
Kenosis of the Light Bearer
Keter
Keybash! GAME JAM!
Kick and His 10 Gaurdians
Kill 10 Rats
KillDozer
Killed, Blessed, Reborn
Killing Amount
Killing Game
Killing X Intent
KillStreak
Kill the Joker: Survival Game
Kinda Dead: The Infernal Escapee
Kindling Stars
Kindred
Kindred Spirits
Kinetics
King
King Above All Others
King Chronos
King Cobra
Kingdom
Kingdom Come
Kingdom of Bees
Kingdom Of Demons
Kingdom of Heaven: The Skull Throne
Kingdom of Monsters: La Guardia
Kingdom of the ANTS
Kingdom of The GhostShepard
Kingdom of the void
Kingdom of Tyr
Kingdom Quest
Kingdom Saga
Kingdom Shattered
Kingdoms of Blood, Magic, and Apocalipse
Kingdoms Online
King Elementalist
Kingmaker
King? Nooooooopeeeee
King of Another World
King Of Ant
King of Glass
King of Hell
King of HOLLYWOOD (Revised)
King of Kings
King of Nobody
King Of The Broken World
King of the Djinn Kingdom
King of the Fall: Origins
King Of The Farm
King of the Mountain
King of the Mountain, Again
King of the undead
Kings Game : The Origin Of A Monster
Kings Game : The Origin Of A Monster (Rewrite)
King's Game : Zixx (The Monster)
King Slime:From an Experiment to A Ruler, Backstory of a Boss
Kings Rising
Kings Rite
Kings: The Fall
King System
Kingun
Kira's second life
Kiri to Shinkirō | Mist and Mirage
Kismet Online: Root Alpha
Kitsune in Rockford
Kiturasha God
K.I.X
Kiyu's Box
Knight & Condemned (Completed)
Knight City Nights
Knight & Condemned
Knight Endeavor: The Crimson war
Knight of the Rising Sun
Knight of the Rising Sun Volume 1: The boy with the katana
Knight's Crusade: Regulus War
Knights of the New Queen: Protector
Knights under a Green Sky.
Knight X Magic
Knowledge and Power
Known Danger System 42
Know Thy Enemy
Kobold
K.O.D. by Lirg123
KOJI FIGHTS THE WORLD! (The Bonder Legacy Book One)
K. O. Romance [ノ ッ ク ア ウ ト ロ マ ン ス]
Kosmos
Kripp's Fate
Kueng Ning
Kurogane's Collection of Oneshots
Kuromori-san's Table Tutorial!
Kuro's Days
Kurouzu 「クローズ」
Kusan The Death Lord
Kyle
Kyle, just the normal scaly long eared Kyle
L
Labyrinthium
Labyrinth of Anchored Moments
Labyrinth of Gods
Labyrinth Of Puppets
Lackluster Adventure of a Side Character
Lacraea: The Slow Journey To riches
Lads of the Triangles
Lady Bunny
La Familia mas poderosa del mundo de Harry Potter
Lagoon
Lainzax
Lair
Laksil
Lamb of Misfortune
Lament of the Fallen
Lamplight
Lamp of Gods- Tales of an Immortal
Lancelot Deep Impact
Lancelot Dungeon
Lances & Daggers
Lances & Daggers
LandFall's legacy
Land of Astria
Land of Athlora
Land Of Dragons
Land of Irith
Land of the Dogs
Land Of Zhelerez
La puerta de Maltras
La Puerta de Maltras eng.
Laruse
Lasershark of The Laserocean
Last Dream
Last Feast
Last flames of the Old World.
Last Game
Last Grace: The Apex of Another World
Last Grace: To the Apex of Another World
Last Hope
Last Howl
Last Nova
Last of the Mage-Kings
Last Ramas
Last Son
Last Voice in the Darkness Series, Book 1 - Survivor
Last wish from Dead past ( on work title)
Late Night at Lund's
Laughing buddha
Lawless
Lawless Ink
Law of Creation
Law of Divine Gates
Law of Shadows
Laws of Defiance
Laws of Fate
Laws of this place
Laws Raine
Layers of Hell
Lazarus: Jove's Tale
Lazily enjoying the new world.
Lazy Ash
Lazy Cat
Lazy Detective
Lazy Man's End of the World
Ldk
League of Meruem
League Of The Void
Leagues Away From The Sun's Light
Learning to be a Bad Guy
Learn to Evolve
Leaving Earth
Left Behind
Left In Sorrow
Left the World as Villager A. Came Back a Mecha Pilot.
Legacy
Legacy: God's Inheritance
Legacy: Lord Alba
Legacy of Darkness: Book 1 - Darkness Ascendant
Legacy of Darkness: Book 1 - Darkness Rising
Legacy of Power
Legacy of the Ancient
Legacy Of The Blade
Legacy of the Damned
Legacy of the forgotten
Legacy Of The Prototypes
Legacy of the spirit king, Spirit Dungeon God edition (Currently being rewritten / revamped)
Legacy of U.L.T.R.A
Legacy of U.L.T.R.A (dropped)
Legacy of U.L.T.R.A (hiatus)
Legacy Of Weapons
Legacy Online
Legend
Legendarium
Legendarium Props
Legendary
Legendary Blacksmith Mage
Legendary Continent
Legendary Cultivating Dragon Assassin VMMORPG in Another Life and Another World (with Time Travel!)
Legendary Elemental Knight
Legendary Exile
Legendary Lords
Legendary Puppeteer Master
Legendary System
Legendary Twilight Farmer
Legend Land: Tale of the Nameless God
Legend of Chase Marcus
Legend of Erina: Celestial Tamer
Legend of Eterna
Legend of I, Reaos Alzerin
Legend Of Kaiser
Legend of Lunos [Dropped]
Legend of Mammon
Legend of Rall Gregory
Legend of the Athanadra | Astrape
Legend of the Blacksmith
Legend Of The Blacksmith King {Hiatus}
Legend of the Conqueror by CyberBeast
Legend of the Empyrean Blacksmith
Legend of the Five Knights 1- Rise of A Guardian Angel
Legend of the Five Knights 2- The Shadow of Justice
Legend of the Gunslinger Mage
Legend of the Heavenly Monarch System
Legend of the Horse Zodiac Warrior
Legend of The Monster Slayer
Legend of the Nameless Hero
Legend of the Perfect Emperor
Legend of the Phantom Hero
Legend of the Sage by Daedalus
Legend of the Sword God
Legend of the Undead Sovereign
Legend of the Void
Legend of Truck-san
Legend of Xeor
Legend of Yzer
Legends of Auroras
Legends of Dorthar: Kato's Tale
Legends of Etheria
Legends of Gods. Tale of Vjaira.
Legends of Tarthirious 4
Legends of Tarthirious, A LitRPG, Book One of Kylia's Story
Legends of Tarthirious: Book Five of Kylia's Story
Legends of Tarthirious: Book Three of Kylia's Story
Legends of the 21st Century (Complete)
Legends of the 21st Century (dropped)
Legends of The Great Savanna - Complete Book 1, Ongoing Book 2
Legends of The War God
Legends of The Wesh: Lochley
Legends of The Worlds Gate
Legends Of Valkyries:Endless war on Middle Earth
Legends of Zyantra: Immortals
Legends Online
Legends Within the Weft
Legend Tales: Fallen Hero
Legend: The Rise Of The Black Phoenix
Legion
Legionary (dropped)
Legion, God of Monsters
Legionnaire
Lein Saviik
Lemme Smash! (Hiatus)
Lemme Smash: The Story of a Living Hammer
Lengend of the Ancient
LEo
Leonel's Workshop
Leonidas The WarGods Commander
Leonora
Leronis
Les Cents Royaumes d'Aldire [French]
Les Kerns de l'Oubli - tome 1 : L'Exil [FR]
Lesser Throne of Seventh Heaven
Leticia
Let's Be Gods!
Lets Conquer!
Let's Define Evil
Let's Explore The New World!
Let's Form a Party to Kill God
Let's Get It Started!
Let's Go Anywhere: The Journal of two Idiots
Let's Invade A Fantasy World!
Let's play a game
Let's Shine
Letters From Beyond
Letters: Naruto's Rebirth and Redemption
Let the games of survival begin!
•Let the Hate Consume You•
Let The World Burn in Ruins
Level Down
Leveling Up Is Better Than Reality
Level Up
Level Up!
Level-Up!
Level Up Lord
Level up or Die: Masochist
Level: Zero
Levia Codex
Levis Magus
Lewd Slime Surpassing The Heavens With Yandere Waifu
Lewis
Ley World-The Game
Lia and Lara will seek the One Piece
Liar Liar
Liars Called
Liberi Fatali
Liberty of Chains
Library Magic
Library of Knowledge - A tale across worlds
Lich in Hero's Realm
Lich. The Depressed Necromancer
Lied
Life and assumptions of Dread The Caveman
Life and Times of Mitch and Akki
Life as a mercenary (Inactive)
Life As a Servant
Life as a solo gamer
L.I.F.E. Begins
L.I.F.E. Begins (Book 1 - Complete)
Life - Break
Life Changing Status Screen
LifeCraft
Life, Death and Other Troubles
Life in a changed world
Life in a Fantasy World
Life In A Galaxy Far, Far Away
Life in another world
Life in another world (On hold)
Life in Death
Life in Newerth
Life in New World (LNW)
Life in Nowhere
Life In Purgatory
Life in Thar'al
Life in the naruto world.
Life in the New World
Life in the North - An Apocalyptic LitRPG
Life is Boring.
Life Is But A Game
Life is Feudal
Life Is Just A Game
Life is not a game: Ice
Life is Pointless in this World Better Find Another One
Life is too short, let's murder to make it longer!
Life is Wilde
Life Magic, An Elemental Fantasy
Life Merchant
Life: New Game +
Life of a gloomy boy
Life of a Hairpin
Life of a Immortal
Life of an Irregular
Life of a person who was transported into another world
Life of David
Life of Evil
Life of Numbers
Life of the dark god
Life Of The Vampire Girl
Life on Jupiter Station
Life Reset
Life Restart: Team Deathmatch in Another World
LIFE - Root
Life Sentence
Life's Exodus
L.I.F.E. Stories
Life Sucks So Deal With It (LSSDI)
Life: The game
Life, the struggle for existence
Life::Uploaded
Life With A Blue Screen
life with Chaos
Light is suppose to be weak
Lightning Does Strike Twice
Lightning Soul Emperor
Lightning Watt
Light of Gemini
Light of Shadows (Dropped...)
Light of the Moon
Light Of The Nine
Light Rays
Li'Kyes the Scaled Hero [HIATUS]
Lilith, the Demon
Lil ko's heart
Lily Bouquet - A Girls Love Anthology
Lily Ex Machina [COMPLETED]
Limerence Somnium
Liminal Radiance
Liminal Radiance: Path Of Old Dreams
Limit Break
Limited Fears
Limiter Off
Limitless
Limitless Adaptation
Limitless Lands
Limitless Lands Book 2, Conquest
Limitless Paradox System
Lineage I
Link
Linked
Lion's Heart
Liquid Magic
Liquid Magics
Lirgaid's Adventure
Lissana
LITRPG (Book II) - Mecc 12 : Cannon Fodder (Unedited)
LITRPG - Planting a Seed (Unedited)
Litrpg What A Fun Way For The World To End
Little Fish Dreameths of the Sky
Little karma game
Little Legs
Little Love
Little master in a new world
Little presence and almost no shadow
Little Thief
Little Thief Not anymore ~
Live by the Sword
Live Fast, Die Young & Leave a Beautiful Corpse
Live Life Homunclus
Lives Of The Immortals - Rise Of The Strongest Magician
Live So That You May Live
Living a Long Life as a Legend
Living Free
Living Happily in Another World
Living in a Fantasy Sucks
Living In A Fantasy World
Living in a Game-Like World, is a Skill (Random Schedule)
Living in another world in peace and harmony i think!!!??
Living in an Urban Fantasy
Living in His Dreams
Living in This World
Living Legend
Living Life as a Demon
Living Life As A Game: Through And Through
Living Life as a Plant in a Magical World, Quite Strange Right?
Living Steel
Living the Fantasy
Living Weapon by Fluflam
Living With Job System On Earth
LMF = Legendary Midnight Farmer
Loading...
Load State 01
Load Them Up!
Locked fates
Logical Labyrinth
Log of a Slime Evolutionist
Loiterous
Loki's Daughter, Tales of the Opal Dungeon
Loneliness
Lonely
Lonely Light (Complete)
Loner Boy
Loners' Aimeless Journey
Lone's Story Playground!
Lone: The Wanderer
Lone: The Wanderer [Rewrite]
Lone Wolf
Long Island
Long War
Looking Down From Olympus
Looking through the window
Looks like I am a Cat-kin now?
Loop of the destiny
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!
Lord Azul
Lord Fear
Lord General Throtand
Lord Grayson
Lord of all vamps
Lord of Dawn
Lord of Flukes
Lord of Glory
Lord Of Horrors
Lord of Inferna
Lord of Monster
Lord of Nightmares (dropped)
Lord of the Apocalypse
Lord of the Branchless Path
Lord Of The Flora
Lord of The Heavenly Villa
Lord of the Night
Lord of the Seas
Lord of the Supernatural
Lord of the Void
Lord of War: Pandæmonium
Lordrian who was.
Lord's Domain
Lord Shadow
Lord Universe Creator
Lore and Legend - The Werewolf
Lore of Hegira
Lorian Ellins
Loser of Tarinath
Losian
Losing My Pride in that Vixen's World
-Lost-
Lost Archive
Lost Blood
Lost Call
Lost Chapters of Eschatology: Vanguard
Lost Child
Lost Concord
Lost Crimson (book 1)
Lost Eden
Lost Emperor
Lost Girl
Lost Heritage
Lost Identity
Lost in Acleirea
Lost in a Magical World
Lost in an RPG World
Lost in Love
Lost in the New World
Lost in the Wind
Lost in Time
Lost in Time!
Lost Lands Online
Lost Leaves
Lost Magic
Lost One
Lost Origins: Ressurection
Lost Realm
Lost Shield
Lost Soul
Lotus Eater
Love at First Theft
Love Gone Wrong
Love Paradox
Love Rewound
Love,War and Astrovia
<< Lucid Dream >>
Lucas Everton
Lucian
Lucid
Lucid Dream
Lucid dreamer
Lucid World
Lucifer Dark the summoned fallen angel
Luck Based?
Luck Lockyer
Lucks Requiem
Lucky Me!
Lucy Wickshire
Luminate Online
Luna
Luna Daemonium
Lurk
Lusarth Fauxun
Lustrous Odyssey
Lust uncontrolled!
Lust uncontrolled! (Complete)
Luxury Cafe Owner
Lyaga
Lyca: Rise of Asura
Lyle
Macabre Mim
Mad Hatter and the Cheshire Cats
Mad House
Madi
Madly insane
Madly insane (dropped)
Madness
Madness with a touch of sanity
Mad Sci Soc
Maelstrom book 1 - A new beginning
Maelstrom Interlude - Defiance
Maelstrom - New Generation
Maestro Therapy
Mafia God!
Mage Hand
Mage Hunter
MAGES: Ascension : Hiatuss Infinitetum
Mage without mana
Magi
Magic Academy ( hiatus)
Magical Adventure
[ Magical Amputee]
Magical Beasts
Magical Fraulein and the World Euphonics
Magical Girl Gang Wars
Magical Girl Selector
Magical Paradise
Magical Popcorn
Magical Puzzle
Magical Tournament: Rise Of The Black Swan
Magic and time
Magica Storia
Magicat
Magic Beast Eaters
Magic Conquest / A Way to Magical World? or Not
Magic Continent Zero
Magic Fighter
Magician Endeavour
Magician's Stigmata
Magic is Overrated
Magic Knight Legends: The Phoenix Empire Pilgrimage
Magick Untold
Magic Lumberjack
Magic Meets Reality; A VRMMORPG Novel
Magic Monsters Money
Magic Online
Magic Swordsman, King Slayer.
Magic System: Becoming a Deity
Magic: The Gathering
Magic turns frowns into smiles
Magic Within: A Thiefs End
Magic Zero
Magikind
Magikind [Original]
Magikind [Rewrite]
Magik Online
Magister Magi: Airon -
Magitist
Magium
Magnus of Theta
Magune: Let The Magnet Rise
Magus Gravity
Magus of Soul
Magus Sunt Inferus
Mahouka x RoyalRoad By lolandylol
Maiden of the Line
Maiden's Moon
Mai Girl
Main Character in Author's World
Maitbudi
Majai
Majeera Chronicles
Majority Rule
Make Me Wanna Die by Rock
Make No Mistakes
Maker of Souls.
Making a Mark In The World
Making an Island
Making an Island (ReWrite)
Making magic, Forging fame.
Making my own Harem
Making the best of a Betrayal
Making the best out of an Accident
Maleficence
Malicious Arts
Malicious Arts Offline
Malicious Arts Offline (Editing)
Malicious, Magical, Malfoy
Mana
Mana apocalypse book one becoming mages
Mana king
Manapocalypse
Mana's Champion
Mana Tank Magus
Mana: The Bay Area
Mana : The Embodiment of Nature
Mana Whisperer
Mana World - Convergence
Mancers Grimoire
Man From Earth
Man from the machine
Manifestations
Manifestations of faith: Return of the creators.
Man in Demon's Skin
Manipulations
Mankind's Judgement
Manmade Monsters (The Permadeath Legacy) (Book 5)
Man of Earth
Man of the Hot Spring
Manor on Server Seven
MANUS DEI (On hiatus. Pending rewrite)
Man With a Mace
Man With Many Faces
Maou Decides to Write a Shoujo
Maou Shoujo Magical Chaos
Maou : Summoning [Hiatus]
Maou the Yuusha
Maple Creek
Marae
March City (Project Lunation Book 1)
March of the Infernal Undead
Marcus Dungeon
Marked Soul
Mark of a dragon
Marred Worlds [Discontinued]
Marroks Guilded Adventures- A DnD Tale
Marrow Marionette
MarSide (Oneshot/Teaser)
Martial Academy (武灵学院)
Martial and Soul Cultivation: Yun Xe
Martial Crafter (Stopped)
Martial Diviity
Martial Family
Martial Flame
Martial God with Naruto System in Another World
Martial Legend
Martial Life Online
Martial Morpher
Martial necro
Martial path!
Martial Rebirth
Martial Road
Martial Spirit
Martial Void King
Martial World
Martial World & Summoned Hero
Martial World (Assasisin)
Mask
Masked Magicians: Savior
Mask of Solitude
Masks: Greed
Masochist Berserker
Masquerade of Life
Master Bard
Master Builder
Master Healer, At Your Service!
Master Magician's Summoned Problems
Masternever And The Flow Of Death
Master of All, Jack of None
Master of All trades
Master of combat in a Different World
Master Of Dungeon
Master of Dungeons
Master Of Everything
Master Of Everything (Completed?)
Master of Experimental Magic
Master of Jade Cauldron
Master of Learning (Book 2)
Master of Learning (Color coded)
Master Of Music (may change)
Master Of The Dark Arts
Master of the Multiverse
Master of the Void
Master of Weapons
Master Thief
Master Trainer Rei
Mastery
Mated To You
Mathew The Mortal
Math God Plane - On Hiatus
Matt's Unfortunate New Life as a Woman
Matty's Misadventure
Max and Myx in Estrella
Max And Rose: Tails Of The Lost
Mayaken
Maybe it would have been a good idea not to wish for a harem?
Maze
M-chan Wars: Rise and Fall of the Cat Tyrant
McShot's Crazy House: Many Stories in One Setting, It's an Anthology!
M'Destiny
Meakashi Collection
Meanwhile
Meat Eaters
Mecha and gun in a fantasy world
Mechanica Fantasy Offline
Mechanical Sect
Mechanization against magic
Mechanoid Gear : Survivor of Trezallion
Mechshift
Mechs? Mex? Mex's mechs!
Medic!~
Medical Wolf
Mediocre in Another World
Medusa and the blind woman
Meeting myself
Mega Cringe: Dab
Mega fantasy
Megane Saga
melancholy Fox
Melancholy of the 31st Demon King
Melee Warrior of Combat
Melio
Mellinnium Myths
Melvin The Necromancer
Memento Mori
Memoirs of an old traveler:First Rebirth
Memoirs Of A Withered Flower
Memoirs of the Broken
Memories in Purgatory
Memories Of Alice
Memory Seal
Me, My Car, and My Dreams Girl
Me, Myself, And I.
Me, Myself, And I. A journey with my Inner Dialogue
Menoitami
Menstex
Mental Note
Mental World Online
Mercenary King
Merchant
Merchant Contract
Merchanting Around The World
Merchant of the End
Mercia: The Bastard Son
Mercury's Daughter
Merdemonel
(Merged into Burra: Short Stories In the Shaper Universe) Enlarge
Meritocracy
Merlin: The man who forged his own destiny
Metahuman
Meta-human: Brainstorm vs Omni
Metahuman Maiden
Metal Elemental
Metalfield
Metal Lich
Metallic Mind (working title)
Metal Samaritan (short story)
Metamorphosis
METAMORPHOSIS - devouring Its way to immortality
Metaworld Chronicles
Metempsychosis
Metempsychosis in the Modern Age
Me, The World and Everything About it
Methodical Mind
Method Of Loci
Metrodome: Tyran
Metropolis
Metsubo Chronicles: The Elites
Metzra: A Hybrid World
Michael Ammers: My OP leisure life
Micro-Management: Survival Base
Midara: Requiem
Middle School Nostalgia
Midgard
Midnight Brigade
Midnight Moonlight
Midnight Raven (formerly known as: LazyTrash's Book-a-ma-bob)
Might
Might of Alchemy
Mighty Sword King
Mikayla the Dungeon?
Milky Way (Wuxia/Si-Fi/Space)
Millennium Dungeon: War
Million Choices
Millstones of Destiny
Milton
Mimicking The Gods [Hiatus]
Mimicking The Gods [Rewrite]
Mimi O Saku
Mindcrawlers
Mind Linker
Mind Net
Mind Over Matter
Mind Reading Isn't Cheating
Mind Stealer
Minecraft: A New Beginning
Minecraft power in a strange world
Minor Mage
Minute Cultivator: Greatest Anomaly Teleported Ever (A.K.A: THE ULTIMATE GENIUS!!!!) o^T-T^o do you even lift bruh?
Mir
Miracle Dungeon
Miracles happens [On Hold]
Miraculous Spider Man
Mironov
Mirror Stone
Mirror World: The Citadel by Alexey Osadchuk
Misadventure of the Goddess of Death
Mischievous Dungeon
Misery and Hope
Misfortune Night House
Misfortune Reborn
Mission Hearthwave
Missteps: A D&D Adventure
Mist
Mists of Ansehelm
Mists of Kel Doran: Season One - Dragon-Touched
Mistworld - Book 1 - Couch Potato Chaos
Mithra
Mitosis: A Battle for Mankind
MLG Gaming
MMO Earth - The Culling
MNR Apocalypse [PAUSED]
Mob Boss of stage 1 (Haitus)
Modern Age Online
Modern Cultivator - The Sperm Who Cultivates
Modern Day Avatar
Modern day Dungeon
MODERN DAY OP-NESS
Modern Deity
Modern Magician In Another World
Modern Magus (Working title)
Modern OP game system... With a glitch! (DROPPED)
Modern Warfare In The Medieval Age
Modern World Mages
Molten Core: The Ascension
Molting the Mortal Coil
Monarch of Heaven's Wrath.
Monday Monster Girls
Money-Grabbing Daoist
Money Grubbing Demon Lord
Money Making MMO
Monition of Magic
Monkeys are Amazing Creatures , Aren't They?
Monkey's Tail
Monochrome Bleed
Monok's Bones: Discovery
Monolith
Monster
Monster Apocalypse
Monster Brethren
Monster Core: Kill All Adventurers!
Monster Core (Revised Version)
Monster Dungeon
Monster Integration
Monster island
Monster Made
Monster Made - Turned into a Monster
MonsterMancer
Monster Masters
Monster Me
Monster of Elements
Monster Parade
Monster Queen
Monster Sage
Monsters Cookbook
Monsters Dwell in Men
Monsters Dwell in Men - B2: Jehovah's Harmony
Monster's Embrace
Monsters Engineering
Monsters invaded earth – I decided to fight without weapons! (Permanent hiatus)
Monsters of Terra: A Compendium
Monsters Paradise
Monster Tamer
Monster Tamer in a World of Monster Hunters.
Monster Yurisume: My lesbian life with Monster Girls
Monstrous
Moon Assassin
Mooncaller
Moonlight
Moonlight Færie
Moonlight Prince and His Uncertainties! (HIATUS)
Moonlight's Love
Moonlit sky
Moons of Orion
Moon Song (On Hold)
Moons' Shadow
Moral Complex
More luck than I expected?!
More than Human? (Hiatus until late June/early July)
Morgana
Morlock
Mormonism in Virtual Reality
Mortal
Mortal God
Mortalis Mortal
Mortal Minds
Mortal's Game (Gods Online)
Mortal Skill God
Mortis Operandi
mortuis -The necromancer
Moskau by G. Zotov
Most Wanted
Mother
Mother Nature
Mother of Learning
Mother of Monsters
Mother World
Mountain Shelter
Mournebane: A world of swords, magic, monsters and dungeons
Mourning Blades
Mourning Glory
Mourning Star
(Moved) RE: Divine Laws of Mind, Body, & Soul
Movie Central
Moving Fortress In Another World
Moving into an SSS Ranked Dungeon?!
Moving Sloth
Mr Dungeon
Mr Mantis [Hiatus]
Mr. Vampire's Wife
Mr. X
Ms Darcy's Apprentices
Mt. Tai in magic world.
Muffins the Barbarian
Multi-carnation
Multiverse Leaper [Dropped]
Multi-verse online
Muna Miracle
Munivit Anima
Murario 2177
Murder of Crow
Murder Online
Murderous Loves
Murderous Urges
Murmaider
Murphy´s Law
Murphy's Law
Musica
Music Masters
Music Masters: CD One
Music System
Must Protect The Saintess' Chastity! (BL)
Mute
Mute.
Mu: The Legend
Mutt
Mu Xiyun: A Lonely Laugh Travelling The Lakes And Mountains
Muzumi
Muzzle and Recoil: The Olympians [Temporarily Dropped]
MVP
My Ability
My adventures in Nope-World or How I came to Fear & Embrace the Horrors of 'Fantasy Australia'
My Annoying Aura Follows Me Into Another World
My another start in another world
My attempt at writing a reincarnation Manhua
My Beauty
My Big Sister Is A Demon Lord | 我的姐姐是個大魔王
My Birthday Wish to be a Dungeon Master was Granted!
My Blind Familiar
My Bodyguard Can't Fight Girls!
My boring fantasy adventure
My Bride is a Moon Rabbit
My cheat skill sucks
My crazy little sister (arcadiablade)
My Cursed Beloved
My Daoist Journey
My day
My Demon Girl
My Demons
My Dungeon
My Elemental Shifter Girlfriend
My Everyday Life With A "Harem"
My Experence in the Starcraft Universe
My eyes can see
My Fantastic World Of Magic
My Father is my Captain?!
My fiance is an alien
My Fiction
My first apocalypse
My First Party Member is a Slime
My first summoning
My Girlfriend: Death
My Girlfriend, the Necromancer
My Godly Body
My Good Friend Murphy
My Grim adventure.
My Grudge is not ending!
My guild was transported to another world, but I'm just the Illusionist Enchanter
My Haiku Collection
My Happily Ever After
My Hermit Life
My Hero Academia: Pathway to the Top
My home is NOT your rest area!
My Hundredth Life
My job and adventure as a Technomancer
My Job is a Tailor
My kind of Eden ( hiatus - will start working on another novel )
My Lazy Days With A Fallen Angel
My Legend as an Evil Hero in Another World
My life after death
My Life as a Dragon's Assistant
My Life As A Fire Hero!
My life as a half-snake
My life as a human knight has begun
My life as a Hybrid
My life as a lesser Rock Elemental
My life as a male harpy
My Life as an Teenaged Antagonist.
My Life As A Superhero Slash Supervillain
My Life In Another Worl
My life in another world - isekai
My life in the anime worlds.
My Life is a Series of Questionable Choices
My Life is Not a Manga, or maybe...
My life is ruled by my character stats
My Life Jumping Worlds. ( mostly fixed.)
My life story in different world
My Life With An Overlord And Anime System.
My Life... With a Twist (will be on hold till summer break)
My Little Abomination
My little slave harem in another world!!
My Love for the Demon Queen
My Luck Was Used as Payment... (ON HIATUS)
My Mythical Odyssey
My never ending cycle of Life and Death
My New Arcane Life
My New Life as a Crow
My New Life In Another World
My New Life on the Otherworld
My New World
My Next Life's Choices Are To Be The Next Demon Queen Or Holy Saint
My Nightclub Landlady
My Obsession
My Orange Glove
My Ordinary Life
My Own Dragon System In Anime Worlds
My Party Member is a Farmer - Literally
My Path of Justice
My Patron is a Sleazy Angel and Basically I'm the Hero?
My Perfect Lady
My personal world
My Reincarnated Life in a Fantasy World
My Revenge: For a lack of a Harem
Myriad Domain
Myriad Life
My Roommate is a Reptile?
My RoyalRoad
My Scary Wife Is So Cute
My School Is Transported Into Another World!
My second chance is as Dungeon Master?
My Second Life
My Second Time in this Terror-Stricken World
My Servant Is Too Overpowered!
My sexy childhood friend returned and...
My Sister's An Alien
My Soul is Yours
My Stepmother's a Witch
Mystery of the Dungeon
Mystfall Chronicles
Mystic Ink
Mystic ink: Mother's word.
Mystic Love Spells Trouble: Crimson Retaliation Volume 2
Mystic Love Spells Trouble: Echo Encounter Volume 1
Mystic: Mark Of The Demon
Mystic Nan
Mystic Pharaoh God
Mystic Reality
My Story in the Otherworld
Mythalia : Dawn Of A New Era
Mytheology
My Thesis Project Online
Mythical Conquest
Mythical Legends
Mythical Tyrant Ruler
Mythic Renewal
Myth: Legend
Myth Of Men
Mythologia
Myth Online
Mythos Online
My Thoughts Exactly
Mythran's Master Of All - Continued
Mythran's Master Of All - Continued (Completed!)
Myth/Real
Mythril Mouse
Myths and Demons
Myths, Monsters, and Legends (Fate/Percy Jackson Multicross)
My Time to Shine
My Trans-Dimensional, Overpowered Protagonist, Harem Comedy is Wrong, as Expected. (Oregairu/Danmachi)
My Travels Through Another World: A Dragon's Tail
My travel to a new game world
My Try at a Dungeon Story
My Tsundere Wife in a Different World (異世界で俺のツンデレ嫁さん)
My Villainess Plans Were Ruined by my Brother!?
My Wish To Acquire 10 Wives
My Witch-Infested Life!
My world
My World Beyond the Closed Doors
My Youth love is a HAREM!!
My Yuri Adventure
NAAO: Serpent
NaClO Adventures
Nadia *Dropped*
Naga rising
Nagol: The Skeleton King
Nailed It
Nameless
Nameless: Ascent
Nameless (Dropped)
Nameless Immortal
Nameless System V 1.00.008
Nanite: Infection (Book 1)
Nanite Magician
Nanite World: A Sci-Fi LitRpg set in reality
Nano Mage
Nanostar Short Stories
[NaNoWriMo] A Flower's Promise to a Reaper's Lover
[NaNoWriMo] Apocalypse Master
[NaNoWriMo] A Simple Life of A Farmer: Farming 101
[NaNoWriMo] A Tower of Hats
[NaNoWriMo]Author's Note
[NaNoWriMo] Don't label me!
[NaNoWriMo] I died and was resurrected... on Earth?!?!?!!
[NaNoWriMo] Masqueraider of Dofus: Incarnam
[NaNoWriMo] The Mortal God's Melancholy
Narbeleth: The Sword of Light
Narice Arkline
Narice Arkline and the Seventh Element
Naruto: After the end.
Naruto : Another story
Naruto Fanon — Generations
Naruto Fans In Another World
Naruto ? I should have chosen Pokemon
Naruto Otsutsuki "The Immoral Legend"
Naruto, The Mercenary of Fate.
Naruto The Reincarnated Narutard
Narutoverse: Cultivation Style
Natalia
Natalia Nocte and the Arcadia Academy
Natural World
Nature Attribute
Nature is a Cruel Misstress
Nature Restart
Nature's Child
Natures Child
Nature's Companion
Nature's Kingdom
Naulo's Corruption
Nav Station Algos
Nebulous Fate
NeckBeard
Necromancer
Necromancer by Halosty
Necromancer of Valor
Necromancer'S Mountain
Necromancer's Pursuit
Necrotic
Necrotourists: The Undead Living the Life
Ned (The weakest species)
Needle Guardian
Need More Points!
Needs More Monsters
NEET No More
NEET of God
NEET Re:Quest High School
Nefarious Affairs
Nefarious Alike
Negative Man
Neiero: The Journey(Dropped)
Neimein
Neither Snow Nor Rain
Nekana, One in Billions, Lost.
Nello & Pastrache ~2nd~ :: (The Reincarnation Story of 'A Dog in Flanders' in an LitRPG Transmigration)
Nello & Pastrache ~2nd~ :: (The Reincarnation Story of A Dog in Flanders in an LitRPG Transmigration)
Nello & Pastrache ~2nd~ :: (The Reincarnation Story of a WW2 Tank in an LitRPG Transmigration)
Nemidos: Tales of a Summoner
Neo
Neo - A LitRPG Adventure
Neo Cosmos
NeoGaea
Neomegalith
Neon Hunters
NeoRealm - Staring back into the Future
Neoshinkei [Cancelled]
Neos Online
Nephilim: Beyond Good and Evil
Nephilim: Descent [Dropped]
Nercokitty!
Nerds in Dungeonia!
Neriehem
Netherwyrm god
Netsuzou Trap
Neutral
Never Forgotten: The Dark Dragon Emperor
Neverland
Nevermore
Never Split The Party
Nevertheless, A Fantasy World
New Age
New Age of Legends
New Australia (A LitRPG)
New beginning
New Beginning Online
New beginnings
New chance
New chance in fantasy
New Dawn Online
New Death
NEW EARTH - A World of Chaos
New Earth, Old story.
New Earth System
New Earth- The Dungeon of Madness
New Eden Royale (A LitRPG Adventure)
New Escape
New existences
New Eyes
New Game
New Game+
New Game Minus
New Game Plus
New hope.
New hope online
New hope online: to
New Journey
New Kingdom Come
New Legends
New Legends: A New Chapter in an Old Book
New Life
New Life +
New life for an immortal soul
New life in AOT(Attack On Titan) World
New Life; New Hell
New Life Online
New Life Online: Battle Against The Strongest
New, New world
New Origin
New Origins Online
New Player Confirmed
New Race
New Reality [HIATUS]
New Reality Online(legacy)
New Realm
New Roads
New Roads!
New Skin
New Soul
New Spartan
New Teacher In Hanbei Academy
New Terra
New: The Dark Inheritor
New to Magic
New To This
New world
New World +
New World: Brave Hearts
New World God
New World Online
New World Online(NWO)
New World Order
New worlds
New world: Survival [Draft]
New World, the battle between light and darkness
New World: The Clan
New World: The path of an avenger
New World: The Tales of Everything that is Wonderful
New world, welcomes the overlord
New world, welcomes the overlord( hiatus)
Next Life: Awakening
Next Life: Reincarnated As an Elf
[Nexus] - Chaos Deficiency
Nexus (Practice Writing)
Neziah, The Glyph Born Lich
Nice things
Nico, The Lord of Nothingness.
Nightchase
NightFall
Night Gaunt
Nighthunter - Beyond the Black Gate
Nighthunter [hiatus]
Nightmare
Nightmare Infinity
Nightmare Phantasm: First wave
Nightmares
Nightmares Game
Night Moves: An Urban Fantasy Adventure
Night Oath Online
Night Slaughter
Nights of Sambria: And the Wish of Light
Night Terror
Night Tremors
Nightwalkers
Nigmus Online [2nd Draft Complete]
Nihil
Nihon no Niko
Niko and the parade of shadows
Nina
Nine Artifacts, Elmyr's Last Errand
Nine Rebirths [Title in Progress]
Nine Worlds Online [REV]
Ningen no Tenshi
Ningen no Tenshin
Ninja
Nirvana
Nirv the Ether System
Noah
NOAH Online -Global Beta Test-
Noah's Ark
Noble
Noble Dream
Noble Merc
Noblesse Oblige: Ascendance
Nocturne
Nocturne: Rise of the Heavy Metal Saint (Vol. 1)
Nocturne (Version 2)
No Easy Mode
No Glory For You
Noh'Doum
No Hero Here (Working Title)
Noir
Noir:
NOIS: A RWBY fanfiction
NoiZ Online
No Level Up
Noli Me Tank in a Mall
No limit
No Longer a Game
No Longer Alone
No Longer Human
Nomad Dungeon
No Matter What, I Will Get Back Home!
No Mercy
No more TRY AGAIN button
(No Name Yet)
None
Non-Existing Killers
Non Human Player
Noodle Knight
No Ordinary Hero
No Respawn
No Respawn [Patch 2.0]
Norex: Summit of Power
Normal adventures
Normalcy is for boring people!
Normal Guy
Norseman of the south
Northern Cloud
Northern God
North Forest
Nosoi
NOSOI (dropped)
Nostalgia
NoS: The Crypts in the Shadow Vol 1 (Hiatus)
No Strings Attached
Not A Hero
Not All Heroes
Not Another Fantasy Story!
Not Another Isekai RPG Story Alternate
Not another zombie apocalypse role playing game
"Not Decided"
Notebook of possibilities
Note Red
Note the Night: Rise of Shadows
Not Getting Involved
Nothing but bones
Nothing goes the way I expect!!!
Not Hurt by the Frost
No time like tomorrow
No title ATM
Not Just Another Day
Not just Numbers
Not Many Get A Second Chance
Not Quite an Author (Yet) [inactive]
Not Reincarnation?
Not the "Support" you were expecting
Not This Earth
Not your average player
"Not your typical Demon King"
Nouvelle chance dans la fantaisie.
Nova
NOVA in the marvel cinematic universe
Novam Vitam
Novarra
Nova Stella
Nova Terra: Titan
Nova Vita.
Novos Hitchhiker
Novos Hitchhiker (Defunct)
Novus Lumen
Nowhere Island University
Nowhere & Nothing
Nowhere to Run
Nox
Npc
Npc 210M
NPC (First Draft)
NPC I want experience
NPCs are the strongest
Null Genesis
Numb
Number One
Number One Commander
Number One Under Heaven
Number One Under Heaven (Old Ver.)
Number One Under Heavens (Tian Xia Di Yi)
Number Two Under Heaven
Nuthouse
Nyaadventure: The Fluffiest of all story! [DROPPED T-T]
Nyanya N. Nya
Nyix
Nyx - The Shadow Princess
O.A.I.
OAO - Olympian Anarchy Online
OAO- Olympian Anarchy Online
Oath
Oban
Obilvion Gates
Oblivion Online
Oblivion Online (complete)
Oblivion Online: Emerald Flame
Obnoxiously Long Light Novel Title
Observation of a Demon Tortoise
Observer 001's inter-multivursal log
Obsession x Mana
Oceanic reincarnation: The adventure of a little Triop
Ocean World of Chaos
Odd Fate - What Other Side?
Odd, How I Got Here
Odds
Ode to Freud
Odins Hall
Odin, the fallen god
Odyssey of the Unrivalled
Of A Title That Is To Be Determined
Of Blood, Steel, and Lasers
Of Cats and Magic
Of Corporate Core Competency Plans, Capitalistic Synergized Growth Projections and Lethal Target Market Analyses.
Of Deities and Dimensions
Of Demons and Devils
Office Workers' World Transfer
Offline
OFFLINE FANTASY: Virtual Deities
Offliner(Cancelled)
Off with the old and on with the new.
Of Gods and Dungeons
Of Gods and Men
Of Insanity and Chaos
Of Life and Light
Of Men
Of Monsters & Men
Of mortals and gods
Of Second Chances and Past Regrets
Of the Cosmos
Of the Cosmos [Historia Terrae Online]
Of The Last
Of The Nine
Of Wolves and Men
Oh.
Oh for the love of....why do I have a reverse harem?[COMPLETED]
Oh good, you're sane again.
Oh great, another dungeon reincarnation!
Oh My Beautiful Moonlight Goddess!
Oh no! My Master suddenly turned into ah...
OH Shit! I broke the seal!
[OLD] Dimensional Befuddlement
Old King's Resurrection
Old Man Logans: Transported to another world
Oldor father of magic
Old: The Dark Inheritor
Old World Online: A Scholars Ambition
Oliver's Wishes
Olympus
Omaye: The First Chronicle Of Zion
Omega System
Omega Wave
Omen of The Days To Come (Title is a work in progress)
Omni
Omnia Online
Omnipotent
Omnipotent Cultivation System
Omni : Strife
Omni-System User
Omniversal War
Omni-Verse Cleaning Monster
Once Again: Evolved
Once a Hero
Once a Soldier Always a Soldier
Once Giants
Once Giants: The Neon Amazon
Once Human
Once Human, Now a Parasite
Once More
Once there was a cat... (Haitsu)
Once upon a Night Time's Dream
Once upon a tomorrow
Once you go Wuxxia you never go back. [(A more or less serious 'Parody') More serious.]
One Above All
One Adventure
One After Another
One body, Seven Lives, and Thousands of deaths
One Body Two Minds
One Chance
One Day Super Powers
One Eyed Ghoul; a Tokyo Ghoul fanfic.
One Eyed Wanderer
One Giant Leap For Mankind
One Giant Leap For Mankind (Revised)
One Hamster Army
One in a Hundred
One Last God
One Life
One Life (Dropped)
One Look to Rule the Heavens
One Man's Journey
One Man's Journey (2nd Draft)
One More Time!
One Must Understand
One Of A Kind
One of Eternity
One Of Many
One of Shadows
One Online
One Piece: A New Player
One Piece - Demon of the Ocean
One piece My story
One piece: My story
One Piece No Go No Ken
One Piece: Pursuit of Justice
One Piece's Messenger of the Sea
ONEPIECE the devil awakened
One Piece: The Elder Twin
One piece - Whatever story
One Piece World
One's Destiny
One Shot
Oneshot - Jack of all Trades: Magical, Mystical, and Miscellaneous Services
One Sin
One Undead Man Armada
One who created!
One with Betrayal
One with Heaven and Earth
One with the Flow
One World Ends, Another Begins (working title)
{ON HIATUS} Legacy Space Academy [18+] {Male Reader x Harem}
On Hold
(On Hold) Regarding my time being a God, it was fun
Onihc's Tale
Only Ashes Remain
Only Human
Only Human Online
Only Me
Only Me wasn't brought to another world, at least for now....
Only the Strong can Survive!
Onmyouji Eclipse
On my way to become the strongest duelist
On the backs of Dragons
On The Battlefield
On The Road To Her Destiny
On The Run: The Love Between Fugitives
Open Fantasy
Open Source
Open World
Operation: Armored Warfare
Operation Re:Code - Project CELES
Operation Sexy Justice
Ophidian Aspect
OP-King and Goddess of Procrastination (Permanent Hiatus)
Opness Is Great For Your Health
OP player in another world!
OP status copy/stealer
Opus Reality
Oracle by Default (Rewrite)
Oraculus Twinmage
Orange Days
Orange you glad to see this berry app(l)e-aling novel, it might even be pear-fect.
Orb Of Oblivion [Dungeon Story RE-WRITE]
Orc Demon
Orc Lord
Orc Planet
Order
Order in CHAos
Order: The Symbolic's Tale of Telekinetic and Family
Ordinary
Orient Online
Origin
Original Dungeon: Web Fiction Ruined My Reincarnation
Original Word
Origin A.R.S.
Origin Dungeon
Origin Manifest
Origin of Chaos (Rise of Anarchy Book 1)
Origin of Power
Origin of the Best Void Magician
Origin of the Invincible Merchant ( On Hiatus )
Origin Online
Origin Online - The Omnipotent Wizard
Origin path
Origin Point
Origins of Void.
Origin Story
OriginStory the VRMMO: The advent of AxeBear
Origin: The End
Orion
Orphans Band
Orphans of a Dead Nation
Osaethar
Oscar Corvus by Raga
Osnos
Other Earth (Through the Mist)
Other West: Diablero
Otherworld
Otherworld?
Other World Badass Minotaur or Not ?
Other Worlder
Other World Exploitation
Otherworldly Adventures
Otherworldly Emperor
Otherworldly Magicians Return
Otherworldly Monster Tamer Chronicles
Otherworldly Teacher
Otherworlds
Other world soldier
Otherworld University (異世界大学)
Other World User Of The [system]
Other World User Of The [system] (Unfinished)
Otherworld Women Are Scary
Our Blood Is Red
Our Cosplay Became Real in Another World
Our Journey to the Other World
Our new Home
Our New World: The Beta
Ouroboros
Ouroboros Online Book 1
Ouroborus
Ouroborus Online
Our Peaceful Lives as an Isekai Pet Owner
Our Shattered Realms
Outcast
Outer Demons
Outer Space Technology & Another World Magic
Out Foxed
Outlands
Outlasting the apocalypse
Outliers
Outlook: The Stars (Consciousness Unbound Book 1)
Out of Foxes to Give
Out of Place
Out of Space
Out of Sync
Out of the Blue
Out of the Wilds
OutRage: Total Realism.
Out There
Over & Over
Overgrowth
Overlink I:The Legend Of The Most Powerful Magic User
Overlord
Overlord Gets Summoned
Overlord of the Spear
Overlord's Fall
Overlord Spirit Martial Emperor
Overlord's Rise
Overlord - The Beast of the Apocalypse
Overmind - The Metamorphosis
Over My Undead Body
Overpower
Overpowered
Overpowered Gosu
Over-Powered Guy In Another World
Overpowered System!
Overrule
Overseer
Overseer (Dwarf Fortress x Worm)
Over the Horizon, and Into The Dawn
Overthrowing Fate
Overture
Overture of an Odyssey
Overturning of Empires
OverVitality
Overwrite
Owning a cute little pet
Paalatoo
Paalatoo (Pet)
Pacific Rim - Overkill
Pacifist - Champion of the Death [ON HIATUS]
Pacifist Run
Pact
Pacternal
Padding the Grade
Pagebreak
Painting the Mists
Pair Of Loving Bird By Cyert
Paladin
Pan
Pancakes and rubber dildos
Pandæmonium
Pandemonium
PANDEMONIUM OF THE NEW WORLD ~The Tale of the Wanderer's Survival~
Pandemonium: The Harbinger (Dropped)
Pandora: A New Beginning
Pandora Box
Pandora's box by MoJo
Pandora's Box (Draft)
Pandora's Scion.
Pangaea
Pangaea Online, War of the Ancients
Pangea: A New World
Pangea Online: Books 1 and 2
Pantheon
Pantheon: Online
Panzer Core
Paradigm Shift - New Beginnings
Paradise Unto Us, Virtual
Paradoxes have unlimited power...
Paradox Fighters
Paragon
Paragon by Compass96
Paragons of the Collective
Parallel (A Virtual Gamer's Story)
Parallel by Midnightsonata
Parallel Lives
Parallel Online
Parallels
Parallel (Vol.1 & Vol.2)
Parallel Vol. 3
Parallel World Vet
Paranoia!
Parasite Paradise
Parasites and Magic
Parasitical
Parrain de Asesino
Party Hard
Party Member For Hire
PartyO4
Passing Onto Fog
Passing Onto Fog / LitRPG Multiverse
Passion For Refining Pill
Path
Pathetic Plant
Pathfinder
Path for freedom
Pathless - [Hiatus]
Pathless Origin: Bane of the Gods
Path of Ascendance
Path of Blood
Path of Damnation
Path of Evil
Path of Evolution
Path of One's Natures Defiance
Path of Philosophy [Dropped...]
Path of Slaughter
Path of the Dominator
Path of the Forsaken
Path of the Fused-Phantom
Path of the Glutton
Path of the Jade
Path of the Mind
Path of the Tyrant King
Path of Transcendence
Pathos
Path (Rewrite of Elf and monsters path)
Paths of Destiny
Path to Godhood: The Silver King
Path to Godhood: The Silver King (RWBY)
Path to Immortality
Path To Obscurus
Path to Origin
Path to the Heavens
Pathwalker: Into Darkness
Pathway of The Butterfly
Patient Zeroes
Paw Luck (Litrpg)
Paztok
PCS to Eden - (I'm on TDY from Hell Book 2)
Peace In Violence
Peace's Payback
Peace's Payback (hiatus)
Peace's Payback (short hiatus)
Peak of immortality
Peaks of Power: Beginnings
Pearl of cold (Old version)
Pedlar of Another World
Peerless Daughter of Heaven (slow/random update)
Peerless Martial Unicorn
Penance
Penance (rewrite)
PenDragon's PicToStory Challenge
Pendraguin
Penitent
Penumbra
Perchance
Perdition [ Scrapped Now] ~ Hiatus?
Perfect Blood
Perfect World
Perla Online: Toris
Perma-Death Online
Permafrost
Persona: Greed of The World
Persona Influx
Perverted God : Second Chance
Petal Fall: Eternal Border Of Life
Peter and the Computer Imp
Petilil - Bottom Up
Petmaster Evolutions
Pet Me?
Phaesporia
Phantasm
Phantasmagoria
Phantasmal Party
Phantasmic Light
Phantasm: The Grim Devourer
Phantom
Phantom!
PhantomaMusica
Phantom Demon [Moved]
Phantom Guns Online By Voomhi
Phantom Lord
Phantom Solstice
Phantom Song
Phenomenal
Philippine Lore
Philippines in Another World (Because Japan is too OP. Please Nerf)
Phoenix
Phoenix Origami
Phoenix Rising
Phoenix Rising: The Beginning
Phoenix Rising v2
Photon shift
Pich
Piece: Pawn
Pierce Through the Heavens and Slaughter Gods
P.I : Eternal
Pilgrims of the Dying World
Pill Ancestor
Pillars of Creation Online (Dropped)
Ping Pong King
Pink Sugar Apocalypse
Pinnacle [Dropped]
Pins or Die!
Pioneer 0: Rise of the machine in a world of sword and magic.
Pirate's Gambit
Pirates of the Milky Way
P.I.R.A.T.E.S. (Profiteering by Instigating Random Accidents To Embezzle Shipment)
Pitch Black Dreams(Completed)
Pixelation: World Most Wanted
Pixie wife
Plague
Plague Children
Plague Lord's Dungeon
Plague Monster
Plane of Darkness
Plane of Darkness: The Battle Against Time
Plane of Darkness: The Beasts before Time
Planet #3
Planet Animax of a god
Planetary Avatar
Planetary Brawl
Planetary Update
Planet Kill: A Dual Harem Pulp SciFi Adventure
Planetouched
Planet Plume
Planet X: Chronicles of the Untiring
Player 47
Player Forty-seven
Player Glitch *paused*
Player's Fall: NPC Takeover
Players of Reality(POR)
Playground of Fantasy
Playground of the gods
Playing with Opness!
Play It?
Play On! My Lovely Goddess! [Rewriting]
Playtime
Please Call Me Teacher!!
Plight of A Lost Soul
Plot Armor
Plunder - Power Stealer
Poetic moments
Point of View
Poison in Paradise - A Star Wars Fanfiction
Pokemon Animus
Pokémon: A Story of the End
Pokemon Black & white: Volume 1
(Pokemon Data-Visored) The Adventure of Viole
Pokemon Integration Project
Pokemon New Age
Pokemon Reincarnated Adventure
Pokemon: Successors of The Forgotten
Pokemon (The Kipy Life)
Pokemon Untold
Pokemon - Vastia (Slow Update)
Polaris Dark
Polyglot ( )
polyglot("NPC_Revolution")
Polymath Redux
Polymath Redux Annex
Polymorph
Post Human
Post-Living
Potter of Life Ariabel [Dropped until further notice]
Pound Of Joy
Powder Keg Balloons
Power
Powerful
Powerless
POWERLESS: The Reborn Saga (NaNoWrimo 2017)
Powerless Villain [DROPPED]
Powers of Majin Buu in a Fantasy World!?
Power Surge
Powertrip
«Powertrip»
Practically, I am weak because "I AM A WEED!"
Praying For My Downfall
Preaching a Lie
Precious converting system
Precipice
Precise
Precursor
Predator/Prey
Prehistoric Barbarian
Prelude: Abyssal Tribulation
Premiere End
Prerequisites for Greatness (RWBY)
Press Start to Play
Pretty girl stranded in another world
Pretty Modern
Pretty sure i am not the main character
Prey No More *Dropped* (Probably)
Pride
Prides & Familiars - A Novel Series
Pride X Kämpfer ReVamp
Pride X Princess ReVamp
Priestess Of The Land
Primacy Online
Primal Beast
Primal Devotion
Primal Gaming: The Murder of Timothy Smithton: Part One
Primal Gaming: The Murder of Timothy Smithton: Part Two
Primal Instinct
Prime Magus of Earth
Primordial Evolutions
Primordial Kingdom
Primordial Law
Primordial Majesty (原始神)
Primordial Origins
Primoris
Prince of Destiny
Prince of Madness: Meteor Shower
Prince Of the Abyss
Princess Aria and the Gem of immortality
Princess Aurora - The hero villainess of another reality
Princess Knight
Princess Rinoa Reudinger
Princess Royale - A Novel Series.
Prism
Prismatic: Tuscan Serpent
Prisoner From The Past
Prisoners of Earth
Private Eye: The beginning of the adventure
Procedurally Generated Shenanigans!
Procession of the Shadows
Professor Vare Wellington Of Magaming Academy
Profit Margin
Programmica Magica
Programming Wizards!
Project:Cineraria
Project Cypher
Project Daily Grind (Mirror World Book #1) by Alexey Osadchuk
'Project Desperia'
Project Dream
Project Exonaut
Project Felia
Project: Gate to new dawn
Project Looking Glass: Freelancer
Project Love
Project: Massacre
Project OMEGA
Project Ordinal
Project Pegasus: An Airplane Crashed into Me So I've Been Reincarnated as a Skeleton
Project SHRINE
Project T
Project TheirWorld: Book Two - Tatterskin
Project: TheirWorld - Book Zero
Project: TheirWorld - Book Zero (Project TheirWorld: Book One - The Tutorial**)
Project: TheirWorld - Book Zero (Tatterskin: Volume One**)
Project X
Project: You have died
Prometheus Code
Promised Daughter: We Call Ourselves the Cursed Part I
Prophecy of Magic
Prophesy of the Elven King
Prophet of civilization
Prospect of Living in this Unforgiving World
Protecting my sister's rivals
Protecting The MC as my game avatar in a wuxia world
Protection of the Vheil – Re-integration
Protector
Protector of the Realm
Protectors (HIATUS)
Prototype
Prototype for another world
PS Arcane Remove
Psionic World
Psychic Brawler Greg
Psychic Hunter
Psychic Maiden (Saikikku Shojo)
Psychics In Another World
Psychobox Robots
Psycho dungeon master
Psycho In A Fantasy World
Psycho in an Unfortunate Apocalypse
Psycho in Naruto
Psycho Kaito
Psychopannychism
Psychopath
Psycho Space
Psychotic Break
Psychotic Death Online
Pun-ished Till the end
Pure Soul
Purgatory=Resurrection
//Purple.Jester
Purple Lightning Emperor
Purrge
Pursuing the Demon Lord
Pursuing the Pinnacle
Pursuing the Pinnacle[HIATUS]
Pursuit Bloodline
PvPer
PvPer Casual
PWNing P2W
Pyramid
Pyramid of Souls
Pyscho Bric
Qi and Other Diseases
Quantum
Quartercup
Queen Of Blades
Queen of Devouring (World System Reworked)
Queen of thieves
Queens (The Wielders of Arantha Book Two)
Quentin Marcus but you can call me '?'
Quest Eternal
Questing
Questioning the Basic
Questmaster
Quest of the Moon
Quests of Silence
Quiet Tales of a Forgotten Reaper
Quietus
Quod Olim Erat
R1: "John's worries about his Harem" and R3: "The Magical girls!"
R3:Monochrome ~An Interactive Story
Raak
Rabbit Eyes [Rewrite]
R.A.B. Online (Discontinued)
Race of Culdovia
R.A.D.E.
Radiance Chronicles
Radioactive Evolution
Radix
Rae Daes
Rage against Divine
Rage and rebellion
RagedEclipse's One-Shot Collection
Rage Summoner
Raghnall: The Tales of Valor
Ragna
Ragnarök
Ragnarok apocalypse, the primordial beast reversion
Ragnarok Cycle
Ragnarök Delayed
Ragnarök : Guardians
Ragnorok online
Raider
Raider (A VRMMO Novel)
Rain
Rainbow Sovereign
Rain Colored Memories
Raine
Rain Revert
Rain's Revenge.
Rain Wanderer
R.A.M.
Ramblings of a Bored man
Rancor
Random One Shots
Random Story
Random Survival - An experiment into humanity
Random Wanderer
Random Words
Random Words - (A Series of Small Worlds Born from a Random Generator. Feel Free to Laugh)
Ranger of the North
Ranker
Rapture Resurrection: The Manifestation of Sin
Rapture: The Bloodstained Chronicles
Rapture: The Bloodstained Chronicles (prototype)
RATS: 252 Chances At Redemption
Ravaged
Ravana
Raven
Raven Knight
Ravenport: Luna's Awakening
Ravens of Death (#2 of HOW)
Raven Squad > The Outbreak
Raven's Tale
Ray-004 (Completed)
Ray-004 (Dropped)
Ray-004 (Ended)
Raylia
Raymond's Raven
Ray's Redemption
Re:
RE: 10 Lives
Re:Absorb
Re:Absorb Redux
Re: Accel Rush
Reaching for Heaven
Reaching for Immortality
Reaching for the stars
Reaching Immortality after Death
Reader: A Tale of Magic
Reader's Catalyst
Realithia Collection
Reality Benders: Countdown by Michael Atamanov
Reality Crash
Reality Grants One Chance
Reality in a Game World
Reality Meets Myth
Reality or Game
Reality or Not
Reality's Gate: Stealing The Gifts Of The Gods
Realize: Fact and Fiction.
Real Life Can Be Interesting Too
Real life in a Virtual World.
Real life offline
R.E.A.L. Life Online: Inception
Real Life RPG Doesn't Suck
Real Life RPG Sucks...
Realmbound
Realmcusp Tavern
Realm Design
Realm Eternal
Realm of Adventure - Volume 01
Realm of Exaltia
Realm of Infinity
Realm of Learning: Adventures of Eternium
Realm of Legend
Realm of Myths and Legends
Realm of Noria. Book 1. The Birth
Realm Of Olde
Realm Of The Forgotten Gods
Realm Online: Trapped
Realm Online: Trapped - An Epic Fantasy LitRPG Adventure
Realms
Realms End
Realm Walker
Real Real Life
RE: Alternate World Online
Real Time Reality
Re: Answer
Re:Ant
Reaper
Reaper Ex Magus: Highborn Herald
Reaper Ex Magus: Messenger Rising
Reaper Of Souls - Messorem Animarum
Reaper of the Martial World
Reaper of the Multiverse
Reaper of the Shadows
Reaper's Game
Reaper's Grimoire
Reapers of Eden
Reaper With The Red Hair
Reaping Pendant
Re:Arbiter of Power
Re:Armor
Re: Arms and Magic
Re: Ascension Rebirth
Reasons to Stay
Re:A Space Story.
Re:Asura
RE: Awesome (Oppai Sensei)
Re:Beak
Re: Beast
Rebel - An Uni Online Tale
Rebirth
Rebirth+
Rebirth and Second Chance [Dropped]
Rebirth Back To Another Parallel World (Zombies)
Rebirth: Hero! [Discontinued]
Rebirth in a corrupt world
Rebirth into a Magical World
Rebirth Missions
Rebirth: Monarchs
Rebirth: New World
Rebirth of a broken demoness
Rebirth of an Accidental Demon Queen
Rebirth of an Immortal
Rebirth Of A Serial Killer
Rebirth of Assassin
Rebirth of Chaos by Lazyanona
Rebirth Of The Commando
Rebirth Of The Elder Lich As A Devine Being In The Mortal World
Rebirth of the Entertainment Giant
Rebirth of the Evil God
Rebirth of the Fallen
Rebirth of the heart of Arcturus
Rebirth of the Heavenly General
Rebirth of The Kind Death God
Rebirth of the Mind
Rebirth of the Sword Emperor
Rebirth of the undead
Rebirth of the Undead King
Rebirth Online
Rebirth Online V3
Rebirth: Rise of the Slave Master
Rebirth To a New World with Nothing but One Magical Slime
Re;Blade
Rebola
RE: Books
Reboot
(Reboot up)
Re:BoredBlood
Reborn
Re:Born
Reborn: Apocalypse
Reborn As A Cute Loli
Reborn as a dungeon core in an apocalyptic world
Reborn as a GOD
Reborn As A Hero...... But Why Did I Freaking Turn Into A Girl?!
Reborn as a Mana-beast, but……why am I a panda?
Reborn as a nine-tailed fox
Reborn as a nine-tailed fox [Rewrite]
Reborn as a skeleton because I'm edgy
Reborn as a Tentacle Monster
Reborn as Living Mana
Reborn as villainess girl....
Reborn Dwarf
Reborn in a Fantasy World... as a girl
Reborn In A Fire: The Nyxe Legacy
Reborn in another world, as a male?!
Reborn in another world with a glass of water
Reborn in Dreams
Reborn in MHA
Reborn in The Marvel World
Reborn into a RPG?
Reborn into a Xianxia World
Reborn into Naruto with full Hollowfication!
Reborn into Starwars! Summoned into Fantasy
Reborn into the RWBY World with a Small Cheat
Reborn loser
Reborn Magician Tyrant [Old]
Reborn (Proof of concept)
Reborn : Soul Legacy
Reborn:The First Berserk destroyer (Dropped)
Reborn - The Last Dungeon
Reborn-----the unexpected tales
Reborn to become the boss of the Strongest Mafia
Reborn to purity
Reborn----unexpected opportunity
Reborn with 1600 IQ
Reborn with a maxed out intelligence skill
Reborn with a Spotted Back
Reborn with the All-Seeing-Eyes
Reborn: Wolf Man
Re: Bow
Re:Box
Re: Branch member
Re: Breakthrough
Rebuilding the Sun Kingdom!
Re: Butler - Otaku Butler meets his Master in Another World?
Recalcitrance
REC Company
Re:Chances
Re:Cheat
Re:Chimera
RE: Choice
Re:Chomper
Reclamation
Recollections: A Guardian forgotten by time
RE:Conquest
Re: Conquest
RE: Cooking knife
Record of a Sovereign
Record of Naruto Verse
Record Of The Immortal Teacher
Record Of The Immortal Teacher (ON HIATUS)
Records of Ren
Records of the Blue Dragoon (TOG)
Records of The Last Land
Re: Corruption
Recovery: Ignis
[Re] Cultivating the Universe
Recursion
Recursive Mirror, Hidden Shadows
Red
Red and White's little conversation corner (Side-story)
Re Darknym
Red August
Red Butterfly - Spirits
Re:death
Re:Deathclaw
Re: Deathclaw Reborn
Re: Death's Melancholy
Re:Demon
Re: Demon
Re:Demon Hunter
Re: Demon Lord
Re:Demon Lord
Redemption
Redemption For The Evil
Redemption of death
Redemption or Revenge
Red Eyes
RedHawk
Re?digimon?
Re?digimon? It is Not! Damn it! What the heck is this?!
Re: Divine
Re:DiViNiTy
Red Mantis and Avenger Doll
Red Moon
Red Moon Cafe
Re: D.O.A
Re: Dragon ball [Cultivation]
Re: Dragonize
Re:Dragon Princess
Re:Dragon,Reincarnated to Another world As a Dragon
Re: Draugr
Red Road
Red Scarf
Red Skies: Worlds End
Red Souls
Red Stardust
Red String OF Fate
Red Thread
Red Thread of Fate
Red twilight Hunter's Chronical
Red Twilight Volume 1 : A Dawning of Power
Red Twilight Volume 2: Long Distance Runners
Red Twilight Volume 3: Worldwalker
Red Twilight Volume 4: The Avatar Awakend
RE:Dungeon Cult
Redwood Crossing (Fantasy/Yuri)
Re: Dystopia (Completed)
Re: Eagle
Re:Eclipse
Re: Elemental God
Re:elemental The Greatest Spark [Hiatus]
Re: Emperor of Calamity
Reencarnacion: Zorro
Re: Ent
RE:Epsilon
Re: Evolution Rise of the Codex
RE:Exiled Royalty
Re:Fantasy
Re:Ferret
Re: Fire
Reflections: Memoirs of a Minder
Reflections: Memoirs of a Minder Book 1
Re:Flight (Dropped)
Reforging theBroken Warrior
Reformat: Adventures of a Battle Academic in a Primitive Land
Regalia Online
Re:Game of Thrones: Play The Cards You Are Dealt
RE: Gamer
Regarding a Certain A.I.
Regarding being reincarnated in another world as a goblin
Regarding my Reincarnation as an Incubus
Regarding My Reincarnation into the body of an Automaton Girl!?!
Regarding The Life of A Certain Fallen Noble
Regarding the Reincarnation as a Demigod
RE: Gargoyle
Regenerator
Regent D
Re:Ghoul
Regis
Regis Spem ( a.k.a. King of Hope)
REGIS the Forgotten
Re: Globus Online
RE: Goblin
RE:God
Re:Golden Age (Inactive)
Re:Grave [Dropped]
Re:Guardian (dropped)
Re:Hammer
Re:Hamster
Re: Harpy
Re;Hell Gate (Hiatus)
Re: Hero and the Demon King
Re: Heroes' Mount
Re:Hero King
Re:Hero's Weapons
Re:Hero's Weapons (Completed​)
Re:Hero's Weapons (on hold)
Re: Hero's Weapons: Reborn
Re:Holy Conqueror
Re:Hulk
Re: Human
RE: HUNDRED -Starting Life in Another World-
Re: Hunted
Re:Hunter
Reicarnated: Dragon-kin
Reign of Darkness
Reign of the first Dynasty
Re:Immortal
Reincarated Into A Anime World
Reincarnaction Is strange
Reincarnate: Avolved (ABANDONED)
Reincarnated and then summoned to VR
Reincarnated As A Created Player
Reincarnated as a Cursed Armor
Reincarnated as a cute little wolf!
Reincarnated as a Dragonman (On Hiatus)
Reincarnated: As a love doll
Reincarnated As A Mob!?!Rise of the Demon
Reincarnated as an Angel- To become the next God Of War
Reincarnated as an Angel-To become the next God Of War
Reincarnated as an Avatar Class Titan in a Fantasy World
Reincarnated as an elf!
Reincarnated As A OverPowered Dragon
Reincarnated as a Pillbug monster
Reincarnated as a Soul Mage?
Reincarnated as a Team Rocket Member?!
Reincarnated as a Tree
Reincarnated as a Troll, how can I stop humans from hunting me?
Reincarnated as a Troll in a Dark Fantasy World
Reincarnated as the Fated Villain
Reincarnated as The Main Character Little Sister and....I Just Don't Wanna Die Again
Reincarnated as the Villainess Older Brother?!
Reincarnated by the God of Creation
Reincarnated Cat Becomes a Magical Beast
Reincarnated Corpse
Reincarnated genius
Reincarnated Genius: My wife is more op than me
Reincarnated : He's my WHAT?!
Reincarnated in a new world with a new life
Reincarnated in Another World, the Adventure of the Pyromaniac Prince
Reincarnated in Naruto
Reincarnated in the world of Ishtaria
Reincarnated into a Lovey Dovey Otome Game World-Who gives a bleeper?
Reincarnated Into Another World With Fairy Tail System
Reincarnated into a weak god
Reincarnated into the DxD World?! (Anomaly #1)
Reincarnated into the World of Naruto
Reincarnated into What?
Reincarnated Legendary Contract Killer
Reincarnated, let's be a pirate.
Reincarnated Supreme Commander General
Reincarnated! The Blind and Deaf Boy
Reincarnated to Another World, But I Think I'm Too Strong.
Reincarnated to immortality
Reincarnated White Beastie
Reincarnated with a living archive of sorcery
Reincarnated with the same world just like Nar***'s?! meh...
Reincarnated Wolf
Reincarnate into Another World as a Bicycle
Reincarnate Into New Worl With Cheat.
Reincarnating into a Fantasy world as an Autonomous Machine Arsenal
Reincarnation
Re: Incarnation
Reincarnation as ???
Reincarnation as a demon: Path to Demon Lord
Reincarnation at the Naruto World
Reincarnation: EVOLUTION.
Reincarnation Evolution - Is it Darwinism or Metamorphism?
Reincarnation: First Monster
Reincarnation Flower
Reincarnation Games.
Reincarnation Games:Dark Wisp
Reincarnation Giver (Editing in Process)
Reincarnation: I am the Villainess and Love Target?!
Reincarnation: Immortal Path
Reincarnation Legend(Dropped)
Reincarnation Luna (On Hiatus)
Reincarnation: Mage Lord
Reincarnation Monster
Reincarnation of an Anomaly
Reincarnation Of A Phoenix
Reincarnation of a Rank 9 Magus
Reincarnation of Napoleon: World of Cards
Reincarnation of The Butcher Alchemist
Reincarnation: Rise of the Rodent
Reincarnation Royale
Reincarnation, Slime, and The world
Reincarnations of a Hero
Reincarnation That Everyone Desires
Reincarnation, the beginning.
Re:Incubus
Re:Insanity
(Re)Install
Re:Interference- Did something go wrong with my Rebirth?
Re: It wasn't a dream!?
Rejection (completed)
Rejoice
Re: Killer Rabbit
(re) Kobolt on Yggmathall
Re:Kotori
Re:Labyrinth
Re:Lamia
Re: Legion
Relevance
Relics
Relics of the past.
Re: Lightning and Iron.
Re:Lives [HIATUS]
Reliving my novels as the antagonist?!
Re: ;Living/Surviving (Barely) in this new world as a Cactus
Re:Loner - Social Skill
Re:Lovely
Re:Luna
Remake is out. (New Name is Masked Hero: The First)
Re:Mana Spirit
Re: Member [HIATUS]
Remember Me Fondly
Remembrance
Re: Merlin In Another World
Re: Mess Up Angel by Vincent84
Re: Mimic (Currently on Hiatus)
Remnant.
Remnant of Shadow(Dropped)
Remnant Redemption
Remnants of Scientific Mankind
Remnant Stars
RE:Monkey
Re: Mountain God
Re:music
Re:Naruto
Re: Naruto.
RE: Necromicy! The Mouse Necromancer!
Renewal Eternal
Re:No Target
Re:NPC in a doomed world
Re:Nymphs
Re:Ocean
Re: O.I.
Re:Oni
Re: Orbis
RE: Orc
Re:Otaku God Reborn As A-What-the-hell-Is-This Randomizer
Re:Otaku Prince life in another world
Repair shop under the stars
Repeat
Re:Pebbles
Repentance
Re: Pessimist
Re: Pokemon Red
Report file 2785: Galactic Unravel
Re:prince Otaku's life in another world
Re: Progenitor
ReProject- Sealed Memories
Re: Psychos
Re:ptile
Re:Quest
Requiem
Requiem of Souls
Requiem to the Stars
Require: Cookie - Book #1 - Mirrorfall
Re: Rabbit Eyes
Re: Rabbit Eyes [Rewrite]
Re:Ranger
Re: Reader interactive
RE: Rebirth Online
RE: Rebirth online.
Re: Reincarnation: EVOLUTION
:Re.re.Re: (Completed)
RE: Revenge! Heavens Crushing, Merciless Divine God Dragon
Re: Rise of a Side Character
Re: Rock
Re:Savior Or ærdéaþ
Re:Scales
Rescendence
Re:Serpent, the Struggles of a 'Snake' to Survive and Evolve...
Reset
Re: Seven Lives
Re: Shapeshifter
Re:Shard
Re:Shinobi
Resident of a New World
Re:Sim
Resist The Blackness
RE skeleton
Re:Skyrim
Re: Slave
Re:Slime
RE:Smith
Resound and Shatter
RE: Space Shoujo
Re^Spawn
RESPAWNED: New Game Plus
RESPAWNED: Original Timeline
Respawned: The Uncharted Lands
Re:species
Re:Spider
Re: Spiderling
Respite of a Fallen World
Restart
Re:Start
Re: Start
Restart!
Restart! [Dropped for now]
Restart (Level Up - 1) by Dan Sugralinov
Re:Stoat
Re:stones
Restriction of Freedom
RE:Summon
Resurgam
Re:Sword
Re: Sword Emperor
[RE] System
RE:Taming a Fantasy
Re:Terra ignota
RE: The Art Of Power- Volume 1
Re: The Ultimate Divine Reborn Unbound Cultivating Emperor Dragon Assassin Summoned to Another World : Online
Retired Hero to --- (working title)
Retiring to the Boundless Realm
RE:tombdungeon
RE: Trailer Trash
Re: Treant
RE: Trump! Make This Fantasy World Great Again
Re: Trump: Online
Return From the Astral Meadows
Returning to Legacy
Return of the dark god
Return of the Demon Lord
Return of the Fallen Angel: Book 1
Return of the Last First Lord
Return Of The Martial God
Return of The Ruler
Return of the Soldier King
Return to Earth Realm
Return To Godhood
Re: Turtle
Re:Underdark (Hiatus)
Re:Utopia
Re:Vamp
Revant
Re:Veggie ;Living (Barely surviving) in another world as a plant
Re:Veggie ;Living (Barely surviving) in another world as a plant (Beta)
Revelations Online
Revenge
Revenge in another World
Revenge of the Dead
Revenge of The Disturbed
Revenge of the Golemman
Revenge of the Shadow God
Revered Expert of Virtual Reality
Reverence of the Weak Minded (Zūnjìng yìzhì bóruò)
Reverse Fantasy online
Reversion
Rêves d'Utica [FR]
Revival of Undead King
Revival Quest
Revive, Reincarnation, Return
Revive Unlimited: War of the Paladins
RE: Void
Revolt Against the Heavens
Re:volutionist
(R)Evolution of zombie
Revolutions
Revolution's Path
R.Evolution- The Border Dispute
Re:Volve
Re:Warrior
Re: White Slime Knight
Re:wolf
Re:World
Rewound and Rewritten
Rewrite
Re:Write
(Re-write) House Cazador: The Imperial Lion
(REWRITE) The Golden Watch Of Hypnosis
Rewrite X fate
Re:Xianxia
Rexist
RE: Young Master
RE:zombie
Rhapsody of Fate and Origin
Rhucon
Ria Rises in Another World
Ribbit ! I became a frog.
Rica Wants Him Dead
Richard Anderson and Grand Survival Games
Richard the Paladin
Rich Sex (Not Suited For Everyone)
Ricochet Island
Riddick/ Against the Heavens
Rifle Girls in Monaco - a Rica Reyes Adventure~
Rift Emperor
Rifters
Rift of the Oculus
Rift of Worlds
Rift Walker
Riftworlds
Riftworlds Online Book 1: Space Opera
Rigel: The Savage World
Righteous Bestowal: Emperor of All
Righteous Fox Immortal (Going through rewrites)
Righteous Fox Immortal (Small Hiatus)
Righteous Prosperous Malicious
Right Hand of God
Riley's second chance
Rina, the Dragonslayer
Ring of Promise
Rinnegan Wielder In Another World
Rise
Rise And Conquer
Rise (A superhero serial)
Rise of Agze'sCanvas
Rise of a legend
Rise of an Adventurer
Rise of Anarchy (God of Chaos Book 1)
Rise of an Emperor [Dropped]
Rise of a Renegade Prince
Rise of a Rogue Dungeon
Rise of a Scarlet Devil
Rise of a Scarlet Devil (Draft Version)
Rise of Avalon
Rise of Demon King
Rise of demons
Rise of Mortal Empires
Rise of Mystic Dungeon
Rise of New Olympus
Rise of Nightflower
Rise of the Beast King
Rise of the Cursed
Rise Of The Dark Queen
Rise of the Death Lord
Rise of the Demon God
Rise of the Desolate Star
Rise of the Dungeon
Rise Of The Element Emperor
Rise Of The Elf Demon Lord
Rise of the Emperor
Rise of the Eternal Dragon God
Rise of the Eternal Huntress
Rise of the Evil God
Rise of the Fallen
Rise of the Goblin Dungeon
Rise of the God King
Rise of the Gods
Rise of the Henchman
Rise of the Immortals
Rise of the Indigo King
Rise Of The Kind Demon Lord
Rise of the Knight
Rise of the Lich!
Rise of the Lord
Rise of the Magic Emperor
Rise of the Mortal Deity.
Rise of the Myriad Emperor
Rise Of The New King.
Rise of the Paladin (Dungeon Hero Book 1)
Rise Of The Rabbit Empire
Rise of the skeleton king
Rise Of The Spider Queen
Rise of the Takeda Clan
Rise of the Takeda Clan: Flames
Rise of the Three Gods
Rise of the Undead Legion
Rise of the Vamper
Rise of the Vampires
Rise Of The World Eater (Dropped)
Rise of the Young Immortal
Rise of Three
Rise of Toki
Rise To Glory
Rise to Greatness
Rise To Power
Rising
Rising from Despair
Rising from hell
Rising Monsters!!!
Rising of the AI Fused Cultivator
Rising Replicator
Rising Sovereign
Rising To The Ancients
Rising World
Ritz Aven : Can I live normally?[Hiatus]
Rivalry I Live for
Rivals
Rivers of Niflheim Online
Riviera Chronicles
Rize of the lackey
Rize of the Undead
Rizing
Roach
Road of live with magic and something pointy or smashing , maybe a little death and some Dwarven bears and beer.
Road of the Dragon
Road to Babylon
Road to Courage
Road to Freedom by Moskatero
Road to Glory / For My Honor
Road To Immortality! Again!
Road to Legend by Verelios
Road to Power by Kephrenh
Road to Ruin
Road To S
Road to the Heavens
Road to Truck.
Roaming Through The Heavens
Roar of Conquest
Robert The Player Deity
Rocket in Wonderland Lost in the Multiverse
Rockstar Romance
Ro Ginger's Abyss Amusement Park
Ro Ginger's Fat Otaku
Rogue Deca
Rogue Dungeon: A LitRPG Adventure
ROGUE GANGSTA (Discontinued)
Rogue Hero
Rogue Mage
Roki
Rolent's First Adventuring Guild
Roleplaying Genocide
RolePranaGenos
Rolf The Barbarian Battlemage
Roll for Initiative
Ron Chee Investigations: Book 1, The Case Of The Missing Beef Bayonet
Ronin
Rooted Ally Dragon (RAD)
ROOT Online
Rose
Rosencrown Academy
Rose of Thorns and Blood
Rough Beginnings: Quest For the Resurrection Stone Book 1
Rough Waters
Rover
Royal Blood Online
Royal Larva
Royal Life Of A Broken Demoness.
Royal Path to Justice
Royal Rebirth
Royal Road for Retiree By v4lkyr13
Royal Rock
Royal Scales
Royal Sinner
Royal Sinner (Version 2)
RozenS : The Linked Book
RPG High School
RPG Nightmare
RPG World: Journey To Zenith Through Breathing?
Rr:Eos 1.0
RTS Gamer In a Cultivators Universe
Ruby_eyes
Rue of freedom
Ruin
Ruin (Series)
Ruins of Majesta - Blood and Cupcakes
Rule Breaker
Ruler of All
Rules-Free VRMMO Life
Rules Of Darius
Rule's? what are those?
Run
Run Boy Run!
Rune
Rune Knight
Rune Mage
Runemaster
Rune Masters
Runes like Veins
Runes like Veins - HIATUS
Rune Universe
Runic Artisan
[Runist]
Runk Academy
Running Across the World
Runt
Runtime Error
Run to the Sky
Rupture - The apocalypse begins
Rush to Level 0
Ruthless practionar
Ruthless Reincarnator
Ruyi
Rwby: Team Swrz
RWBY: The Good Son
RWBY: World Beyond
RWO - Dreams of another world
Rylavia: My New World
Ryley Allard: Demon Law Expert
Ryu Ball
Ryu the smartest man in human history
Ryuu
Ryzan
Sacred
Sacred Brother
Sacred Grounds - Chambers of Wishes
Sacrifice
Sacrilege
Saga
Saga of the Soul Dungeon
Saga of The West Isle Hunt
Sage Fall
Sage Of An Era
Sage of the Soul Kingdom
Sailing everywhere while seeing everything
Saiyan in a Cultivation World
Saiyan In a Fantasy World
Saiyan in an another world: Magic and Swords
Sall
Salt in the Water- A Lesser Dark: Book I (Complete)
Salvation in The Abyss
Samael
Samarian
Samm - The Progenitor
Samsara The Game
Samsara: The rise of Darksteel
Sam: The Journey Home
Samuel's Tale
Samurai NOT
Sanct Diez
| Sanctity Online |
Sanctity Online
Sanctuary
Sand Girls
Sand (Hiatus-2/01/18)
Sands of Elstirr (Dropped)
Sandstorm Story
Sanguine War Era
Sanity Online
Santa's realm
Santax
Saphael
Sarah - Master of Time and Space
Sarth
Sasha
Satou's Unfortunate High School Life
Savage Divinity
Savage Planet
Savage Worlds
Saved Memories
Save Point - A Science Fiction litRPG
Save Point: Reload (Book 2)
Savior University
Saviour
Saviour of the World
Say Cheese!
Scalding Coils
ScaleBound
Scaled Slave
Scale Dungeon
Scarecrow
Scarlet Ascension
Scarlet Ascension(Hiatus)
Scarlet Blood
Scarlet Finale!
Scarlet Moonlight Princess Doki Doki ~ Love Story in Another Life
Scarlet Rhapsody
-Scarlet Surge-
Scarred Mentality
Scattered Islands Online
Scenario 66
Scene Unlocker
Schism
Scholar of sin
Scholar of the Fog
School, social life, superpowers and other teenage problems
School War's
Science or magic or both?
Scientist Vs Magic
Scion of the Void
SCI Stories
Scorched: Trancendance
Scott Rivers and the Orcess
Scourge in the east (book one Rise of a Heathen)
Scrapped Idea
Screaming Whisper, Ballad of Rebirth.
Scroll of Spirits
Scruffy's Adventure
SC to MC
Scum in Another World
Scum in another world|Remake
Scum of Humanity and his Youth
'S Demise
Sea Business on The World Stage
Sealed by Heaven
Sealed Dungeons Anomaly (Sda)
Sealed Mage
Sealed Memories
Sealed Within
Seal of Infinity
Sealords Online: The Kraken
Sean
Sea of Stars Online: The Legacy of An Aegis
Searching for Impetus
Searching for Salvation
Searful - Rise of The Alaba
Seasons
Second Awakening
Second Chance
Second Dream
Second Earth Online
Second Echo
Second Horizon
Second Life
Second life in a Virtual World
Second Life Online
Second Reality: Against Fate Itself
[Second Saga]
Second Shot
Second Terra
Second Wind, legend of Pandemonium (Finished/Incomplete)
Second World
Secretary To A Lazy Goddess!
Secret ! Idol
Secret Log of an Undying Scientist
Secret of the Old Ones
Secret of the Two Kings
Secret of the world
Secrets In The Intersection
Secrets of Ruin (Ruin Book 2)
Secrets of the Legion
Sect Core
Sector 27
Sector Eight (Perimeter Defense: Book #1) by Michael Atamanov
Seed of evolution
Seeds of Destiny
Seeds of Doubt
Seeds of Doubt (Book #1- Soviet Angels)
Seeds of Fate
Seeds of the Divine
Seeing Beyond
Seeker
Seeker of Knowledge
Seeker of Memory
Seeker of Myths
Seekers
Seekers' Game
Seeking Clarity
Seeking Elysium [Volume 1 COMPLETED]
Seeking Heaven: The True Royal
Seeking The Dao
Seeking the Pinnacle[RESUMED]
See You Again in Spring
Seikatsu ONLINE
Seize the Sky
Sekai
Sekai Saikyou na Shoujo
Sekai: The Wonders and Wanders of the forest
Select World
Seleria
Self
Self-Imposed Curse
Self-Insert
Self-insert Madness
Selfishness can be so rewarding
S-elf-y
Sellsword
Semi-Risen
Senad
Sensual Tamer Chronicles
Sentenced to Troll
Sentenced to Troll 2
Sentry
Sent to a New World
Seoyoon's Journey By lin4t
Separate Isles
Septem
Sera
Sera Avi
Seraph, The Savior of the Humans
Serendipity
Serendipity Chronicles
Seren Ynys Online
Serf
Serial Transmigrator
Serifa-The Goddess of light
Seriously a Space Dungeon how odd?
Serpent
Serpent girl Lily.
Serpentine
Serpent's rise
Set Ablaze
Seth daily life
Seth - The Road To Power
Set In Stone: Follower
Set in Stones (Pantheon Dungeon)
Setsuna To Kazami
Settlement of Safehaven - A Hearth Tree Series
Settlement of Safehaven - A Hearthtree Series
Sevenfold: The Fall of Men
Seven's One Shots
Seventh of April
Seventh reincarnation is as a dungeon
Seventh Street Suckers
Seven Worlds, First World: Hungering Frost
Severer of Fates
Severing The Heavens
SEVR-tech Aftermath
Seyran
Sfera Online
Shackles
Shade
S.H.A.D.E.
Shades Darkside
Shades of grey
Shades of the Moon
Shadow.
Shadow and Silver
Shadow by Nimmu
Shadow Contour
Shadow Emperor
Shadow Hand
Shadow (Hiatus)
Shadow Honor (series)
Shadow of a great man
Shadow of a Man
Shadow of Ethura
Shadow of Light
Shadow of Serenity
Shadow of The Angel
Shadow Queen
Shadows
Shadows and Embers
Shadows by the Sea
Shadows in the Wasteland
Shadows of Blood
Shadows of Life and other Dark Fantisy's
Shadow: Sovereign of Kings
Shadow's Reach
Shadowstep
Shadow's World
Shadow- the solo sword master
Shadow Time/ Sumgineun
Shadow Weaver
Shaking The Heaven
Shaking the world
Shallow City
Shambala Sect
Shameless Beverage System
Shameless Hero
Shaper: New Beginnings
Shapeshifters boredom
Shards of Arcine
Shards of Darkness
Shard's of Destiny By Renshiku
Sharing Life With Each Other
Shattered
Shattered Kingdoms
Shattered Masks
Shattered Mind
Shattered Reality
Shattered ~ Reincarnated Into A Parasite
Shattered Soul
Shattered Views
Shattering The Sky
Shatter the Heavens; Slaughter the Gods
Shenanigans in The World of Monster Girl Encyclopedia
Shepherd Moon, 2nd Edition
Sherman: a Novel
She, the one
Shield Titan
Shift.
Shifter
Shifting Forces
Shimmering Star
Shin
Shinia: the tale of Dalton
Shinigami of the Multiverse
Shin Life
Shi no Uta
Shinwa
Shit Hit's the Fan RPG Style (Rewrite
Shitposting in Another World
Shiv-The Child Of Oberon
Shiv - The Child of Oberon - Reloaded
Shocking Miscalculations
Shori Quest- The Herones Series
[Short] behind your smile | 你的笑容 (COMPLETED ✓)
Short Comedy Stories
Short stories
Short stories and One shots
Short Stories by Vielfras
Short Stories: Character Ideas
Shoulders Of Giants
Shovels In Spades
Show and Tell
Showdown at Justice Creek
Shrike
Shut-in Another World
Sibling Rivalry
Sicora Online
Side Character: A Journey.
Side Quest
Side Quest 2: Dealer's Choice
Side Story:Son of Cerberus
Sigil Online: Hellions
Sigurd Morrison's Bug Hunt
Silence
Silent 2.0
Silent Cultivation
Silent guardian
Silent Kingdoms
Silent Lullaby
Silently We Dream
Silent Waves
Silent wrath
Silicon World (Inactive)
Silks and Ash
Silva's Diary - Zero no Tsukaima
Silver
Silver Amelia
Silver Death
Silver Death (Re)
Silver Dragon Syndicate
Silverglade, a Dungeon Tale
Silver heart of oblivion
Silver Nightmare
Silver stream
Silvertongue
Silver Vengeance
Silver Wings
Silvia-Hayni's wild ride
Simádi
Simulacrum
Since When did a Magical World Need Superpowers
Sin Devouring Immortal
SINFONIA: Oneshots
Sing Crier
Singer Wannabe
Singing life Book one - Hatchling
Single Creation
Singularity - The Mystical Intelligence
Sinister
Sinner No More
Sinner's Resolve: An Agent's Wish
Sin of Defeat
Sins, Magic, and Virtue
Sins of the Father
Sins of the Fathers (A Dungeon Story)
Sins of the Heavens
Sinuous Destiny
Siphon
Sired - reader interactive dungeon story
Sister Mage (medical hiatus - sorry)
Siva
Si vis pacem para bellum (Hiatus for two or three days)
Si vis pacem para bellum (Hiatus until completely rewritten)
Six Days Tale
Skeletal Night
Skeletal Rebirth
Skeletal Records of an Otherworldly Undead
Skeleton
Skeleton in Space
Skeleton Sovereign?
Skeptic Loyalties
Skillbound
Skilled Riser
Skillmaster : Haven
Skill Online
Skullhead - Scribbling's in the bones
Sky: A New Beginning
Skyborne
Skyclad
Sky Drifters
Sky Dungeon
Skyfall
Sky Fall Legend
Sky Fall: Legend
Skyfire Magus
Skyforge
Sky Frontier
Sky Jewel
Skyler's Scarlet
Sky Prince
Skyrim: Dragonborn Within
Sky World (TG.Greed)
Slaanesh-chan in another world.
Slam No Basuke
Slaughtering God's Legacy Inheritor
Slaughter System [Hiatus]
Slave 53: The Phoenix
Slave Ascension
Slave Hero
Slavemancer
Slaven
Slaves have no names, (hiatus)
Slaves of Destiny
Slave to Play
Slave Tyrant
Slayer
Slayer of Kings
Slayer of Men, Bane of Empires, Connoisseur of Fluff (UNDER REVISION)
Sleeping Beauty: A Darker Fairy Tail Novel (Hiatus)
Sleeping Titan
Sleep Jump
Sleepless
Slightly Contradictory
Slime
Slime Hero Saga
Slime migration
Slime Puppeteer
Slimes aren't that bad!
Slimeship Independence
Slime's Journey:Tales of Looper[Discontinued]
Slimes live freely
Slimes: The Weakest Monster
Slime Tamer's Chronicles
Slip Hero
Slivers of Mastery
Sloth
Small Boy, Big World [HIATUS]
Small Cell in a Huge Ecosystem
Small Chests Are Fine Too
Small Hopes (Short Story)
Small Medium
Small Worlds
Smite The Deities (STD)
Smith-Knight
Smoke & Fire (Hiatus)
Smokecutter
Smokeworks
Snakeperson
Sniper in Fantasy
Snowfall
Sod's Law (Dropped)
Softly They Fall
Sohure (Sorainella Book Two)
So I guess this is a Video Game World.
So I'm an NPC now?
So I Summoned a Succubus...
Sol
Soladis
Solar Frontier
Solarversia
soldiers cost (Transfered)
Soldiers of Mana
Sole Survivor
Sol - Lord of Fire
Somehow it ended up like this .
Some Older Night
Someone more bored than me.
Something inappropriate
Some Things Never Change
Someway or another; gonna be a god
Somnia Online: Initializing
Somnus Rift : A Welcome to 'Unreality'
Song of Blood and Fire
Song of Change (Cancelled)
Song of Helheim: Reparations
Song of Heroes
Song of Rapture
Song of the Phoenix
Song of the Silver Moon
Song of the Void
Song of Time
Song of Void &Lightning
Songs From Areth
Songs of Legacies: Cavaron [Complete Draft]
Songs of Legacies: Ties
Sonnentanz
Sonny Samhain
Son of ainz Ooal gown [ overlord fanfiction]
Son of Solomon
Son of the Night
Son of the Wind
Son of Thunder
Soon to be World Fever
Sora A Tale Of A Hero
Sorainella
Soralya
Sorcery in Boston
Sorcery of the Fair Folk : First Book of the Feycrowned Series
So, Reincarnation Didn't Work Like I Thought
Soren's Blade
Soren's Blade: A Dark Epic Fantasy Tale
Sorp
Sorrow Dayz
Sorry, but I'm not interested in love.
Sorry To Tell You This But I'm The Main Character!
Sorsier: The planes of Power
Sort of Forgotten
So that's how it ends
So, The NEET Has Half-Demons? (INDEFINITE HIATUS)
So....Turns out imma fallen.
Soul
Souladonis: Monster Hunter
Souladonis: Ouroboros
Souladonis: The Full LitRPG Novel
Soul & Blade
Soul Anomaly
Soul Augmentation
SoulBinder: A Tale of a Conqueror
Soulborn
SoulBound
Soul CLash
Soul Clash: A Legend Arises
Soul Conflict
Soul Construct
Soul Core Online
Soul Cultivator Journey
Soul Devouring Immortal
SoulDive into Soulistra
Soul drifter
Soul Duelist
Soul Dynamics
Soul Eater: New Beginnings
Soul Exchange Program
Soul For Gaia
Soul Forger
Soul Kiln Saga
Soul Lands Nature
Soulless
Soul-Link by Zapper
Soul Magician
Soul Magician at The Apocalypse
Soul Master
Soulmate
Soulmates
Soul Mender
Soul of the Academy.exe
Soul of the Apocalypse
Soul Of The Fallen
Soul Quest Online
Soul Reaper
Soulreaver
Soul's Choice
Soulseeker
Soulshard: Willbender
Soul Singularity
Soul Siphon: The Beast Land Chronicles
Soul Spirits - The Rebirth of Soul King
Soul Split
Soul Status
Soul Status (HIATUS)
Soulstone: Awakening
Soulstone: The Skeleton King
Soulstorm
Soul theory
Soul Trapped
Soul Vessel Psyche
Sovereign God System
Sovereign Immortal
Sovereign of All
Sovereign of Blood
Sovereign of darkness
Sovereign of eventide
Sovereign of Sword and Spear
Sovereign of the Eight Realms
So What If I'm Trash? Who Needs Cultivation?!
So what if I was reincarnated as a fairy? Why does this emperor, handsome overlord Zhen Wang, have to help the hero save
So You Want to Be a Farmer
So, you want to be an adventurer?
Space Age
Space Age Mermaid
Spaced Out
Space Dragon
Space Explorers (Dropped)
Space Games: Training Phase
Space Junk
Spacer's Dream
Spaceship and Dragon
Spaceslime
Spade : Reborn
Spartan
Spartan (Re)
Spatium a Deo Factus Est
Spawn Summoner
Spearheading the Path to Glory
Special Friend X
Special Ops: The Schism
Spectral Regalia
Spectre
Spectre of the Dunes
Spectres & Skin: Exodus
Speechless [Dropped]
Speed Build
Speedster in A New World
Speedy Delivery
Spell Analyst
Spell and Fang
Spell Bound
Spellcraft
Spellgun
Spellsword
Spellsword: I Summoned Hope
Spending My Retirement In A Game
Spider Dungeon
Spider gurl
Spinning The Wheels
Spiral
Spire: Clan of the Holy Fortress
Spirit
Spirit Box
Spirit Caster: The Lost Dragon
Spirit Conductor
Spirit contractor
Spirit [Dropped]
Spirit Empire
Spirit Game-Working Title
Spirit God Shura
Spirit Immortal
Spirit Mage
Spirit Master
Spirit memories
Spirit of Darkness
Spirit Of The Forest (Dropped)
Spirit Sagas
Spirit's Ascent
Spiritsmith
Spirit's Will
Spiritual Growth
Spiritual Point
Spiritual Realm
Spiritual world
Spirit (WhySoSerious)
Spiritworld
Splinter
Splintered Destiny
Split
Split: A world divided
Splitten World
Spoiled (Temporary)
Spooky Hare
Spooky ☆ Scary
Spores Controller
Spore, Stories of Lords
Spread of Chaos
Sprouting Magic
Squire of War 2.0
Squire of War (The Risen Queen Book 1)
Squire of War ( Version 1.0 )
SSSoul: Divine Curator
Stained Red
Stalker #1: The Maiden
Standard Reincarnation Story
Standing on Top
Star Athlete System
Starblade
Starbound: A Space Odyssey
Star Buster
Star Captain Annie
Starchild
Star Child
Starcraft Unbound
Star Crazy
Stardom: Most Talented Prince
Star Dragon
Stardust
Stardust Universe
Star Exile: Singularity (A Scifi LitRPG series)
Starflys Galaxy
Starlight Assassin
Starlight Online
Starlight Road II
Star Lord
Starmage (The Return of Magic, book 1)
Starmyst
Star Ocean
StarPath Online
Stars' Boundless Domain
Star Seizing Monarch
Star Shepherd
Starship Dungeon BK I - Recovery & Adjustment
Start a Fire
Start The Game (Galactogon: Book #1) by Vasily Mahanenko
Starvation March
Starvation March : Voidborn
Star Walker
Star Warrior
Star Wars: Galaxy at War
Star Wars: Lost Hope
Star Wars: Reborn
Star Wars: Silverlight Rising
Star Wars System
Star Wars: The Old Empire (SWTOR Fanfiction Remake)
Star Wars: The Skies Are Ablaze
Stasis
Stats Overlord
Status Breaker Specter: Spectre Fiction
Status Control: Carefree life ahead?
Staying Human
Steampunk Pirates
Steam's Shadow
Steam Whistle Alley: An Adventure in Augmented Reality
Steel Angel and Fairy
Steel Cities
Steele Alchemist
Steeled Heart
Steel Fall
Steel fangs
Steel Glory
Steel Legios
Stellar Bliss One: Peace In The Forgotten Dream
Stellar Realm
Stellar Uprising
Stella's Feathers
Step
Stepping Stones Saga
Sticks And Stones
Still a Hero
Still Ain't Dead
Still Here.
Still images in the depths of hell
Still Life
Still thinking about it
Stitches: A Journey Of Insanity
Stolen
Stonenanny
Stone Of The Covenant ( Dungeon Story )
Stonequiet: A Proficiomancer in Another World
Stone Swords
Stop Calling Me A Demon King
Stop! Dungeon Time!
Stopwatch
Storia: Sins of the Fathers
Stories From a Dark Place
Stories from Jialin
Stories of Adar: Tales from the Abyss Vol. 1
Stories of the Chain World
Stories of the Realms
Stories of the Wide World
Stories of Zaikoto
Stormbound
Stormbringer
Stormjar
Storm of Kings
Stormspike
Story #3
Storybook Hero
Story: Forever After
Story: Forever After - Elf
Story: Forever After - Short stories compilation
StoryMania !
Story of a Killer
Story of a legend
Story of a Turtle
Story Of Beginnings
Story of gods- God Of Balance
Story of how god became a high school student.
story of the Loli demon who has holy magic?!?!?!
Story of the twilights
Stranded in a Strange World(Dropped)
Stranded In Naruto like world
Stranded on the Old World
Strange
Strange Games
Strange New World
Stranger Arcana
Stranger Arcana // Grim Fortuna
Stranger in Another World
Strangers Amidst the Unknown
Strategy's Mistress
Stratus Online: Awakening
Stray In The Multiverse
Stray Sheep
Stream Hero
Streams of Mithril
Street Cultivation - a modern wuxia/litrpg hybrid
Street Hawks
Strength and Power
Strength From Sacrifice
Strength in Silence
Strike The Heavens: Lowest Caste
Striking Chains
Strimména Chronicles
Strings of Fate
Strong Arm Tactics
Strongest Amongts The Strong
Strongest Demon Vanquisher
Strongest God
Strongest Immortal Ninja with a Naruto System
Strongest Protagonist's Aura
Strongest Sorcerer
Strongest Soul Engineer
Stronghold In The Apocalypse
Strong Ones
Struck By Lightning
Struggle
Struggle for Survival
Struggle of the Future Emperor
Struggles of a Slave
Stuck in a Game World with an OP Shop
Stuck in another world with a starship (DROPPED)
Stuck in a zombie world with an OP shop
Stupid Cat
Stupid Love! I Don'T Want You!!!!
Stupid Summoner Story バカの召喚者ストリー
Stygian Mage
Sub
Subconscious Ghost
Subject 0001
Sublime Electricity: The Illustrious by Pavel Kornev
Subterranean Awakening
Successfully Demon Lord
Successors
Succubi's Curse Online
Sudden Death
Suddenly, a succubus
Suffering
Sui Generis
Suits
Summit of power
Summoned Boyfriend Paradox
Summoned Hero
Summoned Hero...But I'm Just an MTL'er?!
Summoned Heroes
Summoned into another world with powerful cheat
Summoned: Looking for Fragments
Summoned to another world, but I'm a coward!
Summoned to Another World with an Interesting Cheat
Summoned to another world with the man I love
Summoned to a Shattered World
Summon em' all!!
Summoner
Summoner Hero
Summoner Reborn - The Arcane Card Battle Stories
Summoners
Summoners Tale by Kolarthecool
Summoner Sunmoner
Summoner with Warhammer 40K System /On Hold/
Summoning Evil
Summoning Shenanigans
Summoning System in the Apocalypse: The Tutorial is in Chinese
Summon Wars
Sundered World Online
Sundown
Sunken Sailor
Sun-Moon Sovereign (阳月君王)
Super!
SUPER! - A Medieval Superhero Story
Super Athlete System
Super Babes: A LitRPG Superhero Harem Adventure
Super Critical
Super Dead
Superficial Story
Superhuman Princess
Superhumans from the Past
Super Important Message
Super Minion
Supernova - The Arrow Enchanter
Super Novice ©
Supers
Super Sales on Supers
Super Science & Fast Romance
Super Soldier not Super Hero
Super Un-Natural RPG
Supervillain
Supervillainy and Other Poor Career Choices
Supervillainy and Other Poor Career Choices.
Supposedly misplaced
Supreme Attainment
Supreme commander: The way of Aeon
Supreme Demon King - By Kaidus
Supreme Dragon of The Twelve Realms
Supreme Emperor System
Supreme Martial System
Supreme Sword Emperor
Supreme Truth of Chaos
Supreme Weapon Spirit: Legend of Maha [Temporary Hiatus]
Surah
Surewinter
Surewinter — Abaddon Online: Book 1
Surge Abinitio
Surging Power
Surpass
Surpassed the Gods
Survival
Survival Game
Survival in the New World
Survival Mage
Survival of a healer
Survival of the Fittest
Survival Online 3
Survival Quest (The Way of the Shaman: Book #1) by Vasily Mahanenko
Survival World RPG
Survive
Survive! - Interactive story
Survive on Coroleya - Decide Your Fate Game
Survive - Terror Infinity Fanfic
Survive - Terror Infinity Fanfic (0.5 rating spammed version~)
Survive The Chaos
Survive The Zombie Apocalypse
Surviving in a fantasy world
Surviving in the Game
Surviving this world with a broken meta! (Will continue in May)
Survivor
Survivor #00071984
Survivors of the Wild
(Suspended) The Helix; The Arc,
Suttomo, El renacer de un clan. (Español)
Suuru
Suzerain
Suzerain Empire
Svartur Nova
Swamp Boy
Swayamvar: Virgin Continent
Sweet Cure
Swept Away.
Switcher
Sword
Sword Fate
SwordGate
Sword Immortal's Rebirth
Sword King of the Abyss
Swordless Martial God
Sword of Ending [English]
Sword of Ending [German]
Sword of Order
Sword Of Wonders
Sword Quest of Enigmatic Souls
Swords
Swords and Blood
Swords, magic and villagers... I guess?
Swords of Eres
Swords of Light
Swordverse Infinity
Sylaria
Sylph: ivy's escape
Sylph Resurgence
Sylvia
Symbiote
Symbols of Magic
Symbols of the Past
Syndicate
Synergy (World Seed)
Syphon Book 1: Not Quite Heroes
System
System Apocalypse
SYSTEMatic Rise: Dragon Blood System
System Descendant: Awakening
System Discovered!
Systemic Creation
System OMEGA
System Programmer
Table Scraps
Tabula Rasa
Tabula Rasa - The blank slate
Tabula Venatus
Tactics System
Tahneen
Taijitu
Tailed Beast
Tailed Beast Goddess
Tainted Ashes
Tainted Bloodline
Tainted Lily
Tainted Reverie
Take my heart
Taken : New Beginnings
Taken to Another World by Mistake
Taking on the magical world
Talbot is bored dropped
Tale about fire
Talents: Activate
Tale of Adventure by Rulpra
Tale of a Knight
Tale Of An Existence
Tale of an OtherWorlder
Tale of Deprived (Completed)
Tale of Kaerus - Dropped
Tale of Lee Duo
Tale of Lolicon in Another World That became a King
Tale of Pathetic Prince
Tale of Ramiel (Completed)
Tale of Ramiel (Ended)
Tale of Rumage
Tale of Serrin
Tale of The Antihero (Rewritten)
Tale of the Devil
Tale Of The Sixth One
Tale of the Spirit King
Tale of the Star Chosen Villain
Tale of the Stone-Born
Tale of the War God
Tale of Yashima
Tale of Zero
Tale on a Shattered World
Tales from Aevolia; The Bladeheart chronicles.
Tales from a fantasy world
Tales From Duraan - The Kamlotian Spring
Tales from The Secret King
Tales of abyss
Tales of a Champion
Tales of A Colossus
Tales of a Dark Gamer
Tales of Adventure
Tales of a Forgotten
Tales of a High Demon and his Peasant
Tales of A Legend: A Hero's Beginning
Tales of a lonely op girl and an evil op demon
Tales of a main character
Tales of a Modern Day Primordial
Tales of An Arcane Student
Tales of an Exile
Tales of a Power Armor Apocalypse
Tales of Argos
Tales of Arnar: Shelter Boy
Tales of a Rural Villager
Tales of Astora: Insurrection
Tales of Astora: Legacy (FINISHED)
Tales of a Traveler
Tales of a Variant
Tales of a Young God
Tales of Demons and Cats
Tales of Emera
Tales of Eterna
Tales of Games and Life
Tales of Giants and Men
Tales of Good and Evil
Tales of Karlund
Tales of Lost Men
Tales of Mana
Tales Of Martial Path
Tales of My Ascension Have Been Exaggerated
Tales of Ofir
Tales of Raze Holocaust
Tales of Rhia
Tales of Sex and Vanity
Tales of Solitude
Tales of Taliesin by Volesprite
Tales of the Blood Princess (expired version)
Tales Of The Cosmos: A World For The Speedster God
Tales Of The Dark Mage
Tales Of The Dark Mage: New Moon
Tales of the Dragon God
Tales of the Gold Immortal
Tales of The Heroic Kingdoms
Tales of the Known
Tales of the Legendary Hero
Tales of the Necromancer Supreme
Tales of the Old World Demon Lord
Tales of the Path to Godhood
Tales of the Rageborn
Tales Of The Rocket Patrol
Tales Of The Undefeated Legend
Tales of the Void Traveler (A Frozen Soul story) (Completed)
Tales of the Witchers
Tales of Tiamat
Tales of Unfathomable Power
Tales of Unfathomable Power/ Tales of the Heart
Tales of Vanta: The Threeway Paragon
Tales of Zelphorite City
Tallrock
Tame
Tamer of Monsters
Tamer Untamed
Taming Dungeon
Tangled
Tangled Peril (A Jake Mudd Tale)
Tang Pao The Thug Returns
Tanks Through Time
Taotuz's Melody
Taran'Kha
Tarot
Tarros
Tarsas a Sci Fi lit rpg adventure.
Tartarus Online
Task Force 1228
Tasteless
Tatterskin (Project TheirWorld: Book Two - Tatterskin**)
Taupe AFK Assassin For Killing
Teacher : Deliquent
Teaching as a NPC (Dropped)
Teaching Heroes of Might and Magic
Team Phoenix
TearFire
Tearha: Keep Walking
Tearing Sky
Tears Saga
Tea-Thricea : Anathema
Technocide
Techno Cultivator
Tec Mage
Teenager in a Changing World
Teldara
Teleport
Telesma
Teletubbies
Temp Agent Wanted
Templar
Temporary Activity
Temptations Of Wrath
Ten
Tenebris Anima
Tenkaichi
Tentacle Lord
Tentacles
Ten Tailed: A Unique Creature
Teonala [DROPPED]
Teos
Tera: Still Untitled
Terminal
Terminus - A Reincarnation Story
Terra
Terra: A Tale of Rediscovery [Mostly Dead]
Terrane: Online
terra viventium By TrinitySMQA
Terror infinity 2nd update.
Terror Infinity- Absolute
Terror Infinity-A new terror
Terror Infinity : Blood Fetish
Terror Infinity- Contamination
Terror Infinity - Corruption Zero
Terror Infinity Countdown
Terror Infinity Etras Revival
Terror Infinity: Life Restart (RW)
Terror Infinity - New Phase
Terror Infinity - Side B
Terror Infinity: Side C
Terror Infinity Side Zero
Terror Infinity: The Tale of Jack P. Hardwood
Terror Infinity - The Third Side
Terrorizing Conqueror
Terrortorial
Tesla Stone and the World of Smoke and Mirrors
Tester
Testers
Test of Endurance
Test of the lost
Test World 01
Tethered Souls
Thaellis A Kingdom Down Under
Tharos Online
That Girl Who's Always Alone At The Back
That is true? Sorry, now it's false.
That One Story
That time I got reincarnated as a saibamen in DBS
That time I got reincarnated as a saibamen in Dragon ball super (DBS)
That which cannot be forgiven
That which does not kill me, makes me stronger
The 1,000,001st Reincarnation
The 1.000 year Great Sage
The 212° Crisis
The 300 - Rebirth and Retribution.
The 33 Heavens Bow for 1 Man
The 7 Realms
The 7th Hero
The 7th Lord [HIATUS]
The 8th Child of the Demon King
The 8th Day
The Abandoned
The Abandoned Disciple
The Abandoned Sorcerer
The Aberrant Magician
The Ability User of Modern Day
The Abnormal
The Abnormal Existence Called The Creator
The Abstract
The Abyssal Dungeon
The Abyss Gazer
The Academy
The Accidental Archmage
The Accidental Archmage - Book 1 (Completed)
The Accidental Archmage - Book 1 (Completed) and Book 2 (On-going)
The Accidental Archmage - Book 2 (On-going) / Book 1 (On Kindle/Sample Chapters Posted)
The Accidental Archmage - BOOK 3 (Books 1 & 2 on Kindle/Book One Sample Chapters Posted)
The Accidental Archmage - BOOK 3 (ON-GOING / Books 1 & 2 already on Kindle/Book One Sample Chapters Posted)
The Accidental Archmage - BOOK 5 (Loki's Gambit)
The Accidental Archmage - BOOK 6 (In Tartarus Dwell the Damned)
The Accidental Tamer
The Accidental Warlock
The Achieving Dungeon
The Adamant Overlord
[ The Administrator ]
The Advent of Gods
The adventourus healer
The adventure of a ...
The Adventure of a certain Guy!
The Adventure of a Spirt
The Adventure of a Wounded Soul (Dropped, sorry.)
The Adventure of Blaze the Saiyan
The Adventure of Futanari Succubus [Dropped]
The adventure of mana
The Adventure of the Demon Lord's Daughter
The Adventure of the Unknown Wanderer
The Adventure of Two Mildly Sociopathic Siblings in a Poorly Designed VRMMORPG World
The Adventurer
The Adventurers!
The Adventurer's Guild(master)
The Adventures of a Black Genderbending Vampire
The Adventures of a Dhampir
The adventures of a disowned duke's daughter
The Adventures of a Necromancer
The adventures of an otherworldly man.
The adventures of a not-so suspicious individual
The Adventures of a Reincarnated Rat! (ON HIATUS FOR NOW)
The Adventures of a Skyrim Modder in Another World
The Adventures of a Unique Snowflake
The Adventures of a Wayward Spy
The Adventures of CH4D
The Adventures of Einarr Stigandersen
The Adventures of Galus
The Adventures of Granny Smith and The Orderly Kevin
The Adventures of Hei Yu & The Quest for The Jewel of Life
The Adventures of Hei Yu and The Jewel of Life
The Adventures of Knox
The Adventures of Nick Cage
The Adventures of Nori
The Adventures of the Mask Maker
The Adventures of Valgrim
The Adventures of War
The Advisor *paused*
The Advocate Saga
The Aesthetica of Slumber
The Afterlife, And How To Survive It
The Afterlife, And How To Survive It (Barely)
The Afturlife
The Age After
The Age of Immortality
The age of Liorenth
The Age of Man
The Aggresive Cheater
The Ala of Alius
The Alchemist and The Herald
The Alchemist of Rozarre
The Alchemist: Rewind
The Alchemist's Tale
The Aliud: The New Thunder
The Alliance with Rosenhein Kingdom by nooborto
The all invincible arrogant bastard
The Almighty Boulder
The Almighty Reality Manipulation System
The Alpha
The Alpha Male Initiative
The Alpha Male System
The Alpha's Queen
The Alpha Tester's Journal
The Alpha Virus
The Altered, The Augmented, And The Ascended
The Alternate Earth
The Amazing Cleavage: The Adventures of a Battle Axe
The Ambassador's Clerk
The Amber Balance
The Anarchist
The Ancestor
The Ancient
The Ancient Era
The Ancient Relic (Axed)
The Ancient's Son
The Android Project: Legacy of Souls
The Angelic Knight by Silverhip
The Angel's Love
The Angriest Man In The Wasteland
The Anima Dimension
The Animal God's Joke
The Animator
The Anime Trope System : Stone vs. the Viper # 1, a LitRPG.
The Anime Trope System : Stone vs. the Viper, a LitRPG.
The Anomalous Symbiosis
The Anomaly
The Anomaly: The Elemental Saga
The ant
The Antagonist
The antagonist's daughter
The Anthology
The antisocial hero
The Ant King
The Apathetic Life of Ares Mercier
The Apex
The Apocalypse
The apocalypse happened and it was named- The system's advent
The apocalypse that saved the world
The Apostle of Chaos
The Apprentice of Arabella
The Arach King
The Arbiters
The Arcane Archives
The Arcane Emperor
The Arcane Seeker
The Arcanist
The Arcanist (OLD)
The Archaic Ring
The Archaic System - A New Beginning
The Archer of a new world
The Archivist
The Arduous Life of Argent
The Armoura Chronicles
The Arrayist
The Arrogant Young Master tramples the Heroes
The Artifactor of Life by Zeth
The Artificer
The Artificer: A Viridian Gate Online Novel DLC 1
The Artificer's Workshop
The Ascendancy of Humanity
The Ascendant: Autumn Visage
The Ascendant: Endless Reincarnation
The Ascension Chronicle
The Ascension Games
The Ascension System
The Ash Eel
TheAssassin&TheKnight By SkyCain
The assassin in the other world
The Assassin's Creed
The Assassin's Journey to Become the Strongest
The Assassin's Shadow
The Assassin Who Always Somewhat Succeeds
The Author Of Eternity
The Automaton
The Avenger
The Awakened
The Axe Master
The Ayda Series
The Azra-El Series
The Azure Dragon
The Back Room
The Bad Guy Always Wins
The Balance
The Bane of Heaven and Earth
The Bane of Secomber
The Bard
The Bard: A LitRPG Short Story
The Bardic Path
The Bastard Guardian King
The Battle Mage
The Battlemage [FINISHED]
The Battle of Two hearts (Completed)
The Battle Princess
The Beacon
The Beast
The Beast By Halosty
The Beast Gamer
The Beast Master
The Beast of Kulain
The Beast Tamer and His Harem
The Beaumort Society
The Beauty Of A Tragic Path
The Beetle: Monster. LitRPG series book I
The Beginner (Reader-Interactive Project) by Geosiege
The Beginner Village
The Beginning
The Beginning After the End
The Beginning- Breath of War
The Beginning Of A Legend
The beginning of the end of the gods
The Beginning of the Sentinal (Stopped)
The Beginning, The End, And Everything In Between
The Being From Beyond Creation
The Berserk Destroyer Volume 1
The Berserker Knight
The Best Man In Another World
The Bet (dropped)
The Better Side Of Evil
The Big Bang System
The Big Red Button
The Binding of the Dragoon
The Biomes
The Birth of a God
The Birth of a New Legend
The birth of the Destroyer
The Birth of the God of Mana
The Bit of Human Left
The Black Citadel
The Black Company: Epic of Hannibal
The Black Dungeon
The Black Eagle
The Black Empress
The Black Fleet
The Black Knight and The Little Keeper (Dropped)
The black knight Rising
The Black Librarian Archives
The Black Lord's Promise
The Black Ninja
The Black Reaper
The Black Retreat
The Black Rose
The Black Sheep Prince(complete)
The Black Slime Saga: The Classic Reincarnation Story
The Blacksmith Rebirth
The Black Soul (Evo Saga)
The Black Water Dungeon
The Blackwood War - Book One - Ice Queen
The Blazing Boy
The Bleak Walker
The Bleak Walker (on hiatus)
The Blood Champion
The Blood Debt Chronicles
The Blood Emperor [Dropped]
The Blood God
The Blood Goddess
The Blood Mage
The blood of sovereign
The Blood Prince
The Blood-Soaked Circus
The Blood Sovereign
The Bloody History of Leonce
The Bloody Legion
The Bloody Titan
The Blue City- A Summoned 'Hero' (Slow Update)
The Blue Emperor
The blue-eyed hero and the red-eyed assassin.
The Blue Mage of Power *Temporary Title*
The Blue Mage Raised by Dragons
The Blue Rose
The Blue Tower
The Blue Wizard
The Book Jumper
The Book Keeper & The Wolf
The Book of Flame
The Book of Heresy
The Book of meme
The Book of Mors: Summoned
The Book of Rune
The Book of the Universe
The Bored God Decides to Meddle
The boring yet exciting life of Green Johnson
The Boss of Beginner's Village
The Botched Summoning
The Bound Dungeon
The Bounty Hunter
The boy
The Boy and His Hunger(Discontinued)
The Boy and the Dragon's Vengeance
The Boy and The Void
The Boy Named Billy
The Boy Slain By Coffee
The boy who became a girl
The boy with demonic roots
The Branding of Fate [Hiatus]
The brave saint
The Bread Maker By Zed019
The Breath of Creation
The Breath of Creation [DROPPED]
The Bridge, A Science Fiction Survival Story
The Bringer
The Broken City
The broken links
The Broken System
The Broken World
The B-Team
The Bucket List
The Bureau
The Burning of a Home
The Burrow
The Butler of Night
The Cactus Prince
The Cage
The Calamacy
The Calm Death God
The Card Dealer
The Caring Dungeon
The Castaway Isle
The Casual
The Casual Player Killer
The Cataphract
The Cats and the Elves
The Cat that Transmigrated to a World Ruled by Mice
The Cavern
The Celestial Blade
The Celestial (on hiatus)
The Celestial Scholar
The Chain
The Chains of Time
The Chalice Quartet
The change apocalypse
The Changed World
The Changeling
The Channeller
The Chaos Immortal
The Chaotic Life in a Different World
The Charm of a Sweet Philosophy
The Chase (need help with title)
The Cheater
The childish Immortal
The Child of Chaos
The Child of Ebon
The Child of Obsidian
The child of the heroine and demon king
The Children of Destiny
The children of Gods
The child who defied the heavens
The Chimera Liberation Front
The Chimera's Dungeon
The Chosen
The Chosen: Colossus of Evil
The Chosen One
The Chosen Ones.
The Chosen Stars - A Transformers Original Continuity
The Chosen Tatas
The Chosen: When Worlds Collide
The Chronicle of Karl: Industrialization of Rohrkadia
The Chronicles Of Ajadire
The Chronicles of Allen Walker
The Chronicles of Artharian Dagworth
The Chronicles of Daniel Nonamov
The Chronicles of Lute Dragoon
The Chronicles Of Mystery Land: The Quest For The Golden Sword Part 1
The Chronicles of the Beast Master
The Chronicles of the Immortal God
The Chronicles of the Insect tamer (post pone)
The Chronicles of the Legendary ****
The Chronicles Of The Lost Hero
The Chronicles of the Rift and Abyss: Genesis of Immortalis
The Chronicles of the Rift and Abyss: The Odyssey of Lucarius Trinity
The Chronicles of the Slime Dungeon
The Chronicles of the Watcher(Dropped)
The chronicles of Tinker
the City
The Cleansing
The Cloaked Fallen
The Clockwork Man
The Clockwork Raven
The Clone Saga
The Codex
The Cog in the Machine
The Collapsing Dimensions
The Collector
The Combat Crafter
The Coming of Magic : A World in Chaos
The coming of the Angel
The Common Aims
The Compassionate Killer and his travels in a new world
The Complete Box And The Lost Child
The Concubine's Tomb: A Dungeon Core novel
The Conductor of Apollo
The Conduit
The Confused Explorer
The Conquering Couple
The Conqueror
The conquerors
The Contact Person
The Contorted Gift
The Conversion: Rise of the Black Flame
The Cooking Master
The Corrupted One
The Corvus Saga : The Recluse King
The Cosmic Series: Inheritor of Rage.
The Cosmic Series: The First Apprentice. (On hold(life problems.))
The Cosplay Illuminati Abduction
The Costa Brava Scenario ( formerly: Space Opera )
The Couple
The Court of Souls?
The Cradle of The Lonely Crown
The Craft among the Stars
The Crafter
The Crafting Hero
The Cranium Chronicles
The Crash
The creation of Death
The Creative Truth
The Creator
The Creator - Old version
The Creature from the Dark
The Creep of Fate - Dropped
The Creepy Dungeon
The Crest of the Emperor
The Crimson Chronicler series: Dead Dusk (pre_ side-story)
The crimson chronicler - Volume 1: Descent of desolation
The Crimson Demon king - Scarlet D Lucifer
The Crimson Empress (BL)
The Crimson Legion
The Crimson Mage
The Crimson Sand
The Crimson Void
The Crippled Lord
The Crossing
The Crow
The Crown of Judgment
The Crown of Sorrow
The Crowns of Dalmarck
The Crucible
The Crucible - (Terror Infinity Fanfic)
The Cruel and Arrogant Bastard
The Crux of Human Suffering
The Crystal Dungeon
The Crystal Forest
The Crystal Ring.
The Crystal Sage
The Cube
The Cube - Discontinued
The Culling
The Cult
The Cultivating Slime
The Curio Shoppe
The curse
The Cursed Adventurer
The Cursed Dragon
The Cursed One
The Cursed Seed
The Cursed Star
The Cursed Throne
The curse of eternity
The Cycle
The Cyclical Nature of Time
The Cyneweard
The Daily Cheats System
The Daily Diary of a Mushroom
The Daily Diary of a VRMMO-playing Dragon (Complete)
The Daily Grind
The Daily Life of a Divine Soul
The Daily Life of a Supporting Character
The Daily Lives of Ordinary High Schoolers
The Damaged Druid
The Damned
The Dao Emperor
The Dao of Eros
The Dao of Magic
The Dared Damian
The Dark Alleys
The Dark Angel
The Dark Demon Lord
The Dark Elto Du Yu Lin
The Darkest Age
The Dark Hierophant Saga (Complete)
The Dark Hierophant Saga (Eldritch Night Rewrite)
The Dark King's Older Brother
The Dark Lands: A Villainess's Guide to Settling into Her New Home
The Dark Moon
The Darkness
The Darkness's Return
The Darkness's Truth
The Darkness that Follows
The Darkness Within
The Dark One
The Dark (Part 1)
The Dark Side
The Dark Soul Chronicles: Soul Warlock
The Darkstar Prophecy
The Dark Swordsman
The Dark Veil
The Dark Wish Maker
The Data [Abandoned]
The Daughter's Driver
The Dawn of Blood
The Day it all began
The Day We Got Into This Magical World
The Day We Left [DROPPED]
The Deadliest Blade of Grass
The Dead Walking
The Dead World.
The Deal
The Deal was beginning
The Deal was beginning(Hiatus)
The deal was beginning (Rewrite)
The Deal was just beginning
The Death God
The Death God's Daily Troubles
The Death Simulation
The Decendants of Heaven and Hell
The Deeds of Amber Rose
The Defective Hermit
The Definition of Defiant
The Deific Wordsmith
The Demon Against the Heavens
The Demon and The Angel (complete)
The Demon and the Princess
The Demon And The Sword​
The Demon Child - Awakening
The Demon Child Who Inherited the World
The Demon Emperor
The Demon Emperor, first book of "Disciples of The Strongest" series
The Demoniac Hero
The Demonic Army from another world
The Demonic Celestial
The Demonic Conqueror
The Demonic Dungeon
The Demonic Gamer
The Demonic Servant
The Demon King and his Seven Queens
The Demon King And The Fifth Hero (악마 왕과 다섯 번째 영웅)
The Demon King Shall Save The World
The Demon King's Seventeenth Wife is Scary
The Demon King's Wife?!
The Demon Lord Among Heroes
The Demon Lord and I
The Demon Lord and Me
The Demon Lord becomes the hero? DROPPED
The Demon Lord Candidate
The Demon Lord is Bored
The Demon Lord's Lover
The Demon Lord who wished to be a Hero
The Demon Lord will have his revenge
The Demon of Shadows (Hiatus)
The Demon Of Song.
The demon of the past
The Demonologist: The Beelzebub Job
The Demon Prince
The Demon Prince: Avatha Magic World [KDL]
The Demon Prince: Magic World
The Demon Queen (On Hiatus)
The Demon's Adventure
The Demon's Gate
The Demon's Gate *Hiatus*
The Demons Inside Us
The Demon Within
The Descendant
The Descent of Gods and Demons [Dropped]
The Designated: Out of Control
The Destiny Detour
The Destiny of a Mortal God (Hiatus)
The Destroyer
The Destroying Protector
The Destruction God
The Devil King
The Devil Of The Triad
The Devil Reborn
The Devil's Chosen
The Devil's Chronicle
The Devil that None Knows
The Diamond Of Eve
The diary of a monster hunter
The Diary Of A Successful Villain
The Dicer
The Die Electric Wars: Book 1
The Digidream Chronicles
The Dimension Ripper
The Diplomat Class
The Disobedient And Barbaric Daughter
The Distant Stars of my Dream
The Divide
The Divided Lands: Openings
The Divine Apocalypse
The Divine Assistant (The Gods of Tergia, Book 1)
The Divine Erinyes
The Divine Path
The Divine Traits
The Divine Works
The Divining
The Dog that Cultivate
The Dol En Galaxy
The Doll That Fell to Earth
The Draco Lich
The Draconic Lord Rises (Book 1)
The Dragon clan
The Dragon Clan Revived
The dragon dungeon
The Dragon Fiend
The Dragonfire Tournament
The Dragonfire Tournament - an interactive story
The Dragon God
The Dragon King
The Dragon of Rosemont High
The dragons roar
The Dragon's Wrath: A Virtual Dream
{The Dragon Within}
The Draw Of The Unknown
The Drifter
The Drop Sinister (DROPPED)
The Drow Empire saga
The Drowning City
The Dual Cores - A Dungeon Core Story
The Duesphage
The dungeon
The Dungeon Boss's Favorite Game - A Virmo Story
The Dungeon Calls for a Sage
The Dungeon Era
The Dungeon Gods
The Dungeon Hive
The Dungeon Hive- Volume 2
The Dungeon Hive- Volume 3
The Dungeon King
The Dungeon Masquerade
The dungeon masters
The Dungeon Master : Void
The Dungeon Of A Forest God
The Dungeon Of Chaos and Impossibility
The Dungeon of Crystal Gems
The Dungeon of Evolution
The Dungeon of Grey
The Dungeon of Potential
The Dungeon of the Ascended
The Dungeon Pact
The Dungeon that should not be
The Dungeon Traveler
The Duo
The Eagle's Flight
The Earth after the Reset.
The Earthen Immortal
The Earthians
The Earth Is Hell's Playground.
The earth strongest human.
The Echelon Tower
The Eden Project
The Editor Said No Clichés
The Egg Guardian
The Egotistical Ruler [DROPPED]
The Eight Campione
The Elder of Mediocrity
The Elder Vampire
The Eldritch Assassin
The Eldritch Knight
The Eldritch Monarch
The elemental
The elemental brawler
The Elemental Dungeon
The Elementalist
The Elementals
The Elements of Terra
The Element's Plane
The Eleventh Hour
The Elf Lord of The Dark Tower
The Elven God (Hiatus)
The Elven Paladin
The Emblem of Love and Hate
The embodiment of pain, sadness, and hatred
The Empath [hidden]
The Emperor
The Emperor's Weird Little Trick
The Empty Valley Cries Unheard
The Empyrean Overlord
The Enchantments(Volume One)
The Encroaching Rift [Dropped]
The Encroaching World
The End
The End And New Beginning For A God
The Endings Epilogue
The End is Just a Beginning
The Endless War
The End (LitRPG)
The End of the Princess
The End of the World! Kinda?
The Entertainment of the Galaxy
The Enthusiastic Rise of The Barrier Hero.
The entity
The Envoy From the Heavens
The Epic of Gaia
The Epic of Galia: She Watches
The Epic Of Placeholder McGee
The Era Before(Discontinued)
The Era of Wulin
The Errors I Made.
The Essence of Villainy
The Eternal
The Eternal Dragon
The Eternal Emperor
The Eternal Halloween
The Eternal King of Darkness
The Eternal Tournament
The Eternal Vagabond
The Eternal Vanguard
The Eternity Acts
The Eternity Games
The Ether Collapse
The Ethereal Expanse
The Eveningtide
The Everlasting. (Completed)
The Everyday Life of A Pathfinder
The everyday life of James Moriarty
The evil General Midboss of the Hero Legend is...me?
The Evolution Games
The Evolution of a Snake
The Exalted
The Exalted King
The Exciting Life of Intent Otsutsuki
The Exile
The Exiled Prince
THE EXODUS (RE:Noah's Ark)
The Explorer's Guide
The Exposer
The Fabled Islands
The Fairy-Tale Hero
The Fake Rune Mage
The (Fake) Valentine's of the Shield Hero
The Fall
The fall and resurrection of Draconia of deathninja
The Fallen
The Fallen Ascending
The Fallen God Saga
The fallen (?) hero and Aži Dahāka's soul fragment
The Fallen Legion: Accidental Renegade
The Fallen Magus
The Fallen Nobles
The Fallen One
The Fallen Order
The Fallen Prince
The Fallen Star
The Fall of Chiros [Dropped!]
The Fall of The Gods
The Fall Of The Tribes
The Fall of Vaasar
The False Warlock
The Famed Expert
The Family Business
The Family Fellowship
The Fantasy tropes Encyclopedia
The Fantasy World of Raizel
The far cry of an anti-hero
The Far Edge of Fate
The Farmer Mage
The Fata Morgana
The Fate of Gaeis
The Fate of Light
The Fate of The Summoned (being ReWritten)
The Father of All
The Favour
The Feline Faction
The Female Halfbreed
The Fiasco
The Fiery Fox
The fight for freedom
The Fight for the Mirkwood Kingdom(completed)
The Figure Behind the Dress
The final boss refuses to die
The Final Frontier
The Final Judgement (Volume 3 Out Now!)
The Final Quest
The Fine and Wholesome Activity of Chasing Shadows
The First Adventure - GameLit Portal Fantasy (prequel to the Feyland Series)
The First Archmage
The First Ascension
The First Boss
The First Dragonkin
The First Dungeon
The first enchanter
The First Encounter[Closed]
The First Evoker
The First Heroic Saga
The First Life's The Hardest
The First Mage
The First Outsider
The First Rabbit Dungeon
The First Realm
The First Shadow Assassin
The First Shot - A Two Worlds Short Story
The First Support
The First Testament: Rebirth
The First World Emperor
The fisher and the beast
The Five Lords
The Five Secrets
The Fleet
The Flesh Elementalist
The Flight To New York
The float of a life
The Flower Shiro found under the Moonlight
The Fool of Pendragon
The Forbidden Arts
The Forbidden Class
The forbidden cultivator
The Force Missileer
The Forerunner's Odyssey
The Forest.
The Forest Dreams (Formerly Magic Research Journal)
The Forest emperor
The Foretold: Sun Child
The Forgotten Ancient
The Forgotten Demon King (VR-MMORPG)
The Forgotten Devil Fruit
The Forgotten God
The Forgotten Hero
The Forgotten Kingdom & Its Otherworldly King
The Forgotten Lands
The Forgotten Light
The Forgotten One
The Forgotten Portal
The Forgotten Prince
The Forgotten Race
The Former Cultivator Who Now Plays VRMMORPG's
The Forsaken
The Forsaken Lands of a Forsaken Dungeon
The Forsaken of Amaryth
The Forsaken Ones
The Forsaken Race - The Hidden Truth
The Founding of the Bloody Promise
The Four...
The Four Beast's Reincarnation
The Four Corners
The Four Knights of Eden
The Four Phases
The Four Territories (Sample)
The Fourth Faction
The Fourth Prince
The Fourth World
The Fox With No Tails- REVAMPED!
The Foxy Dungeon
The FPS Deity
The Fracture
The Fragile Monster Lord
The fragile Saint
The Fragile World
The French Conflict
The Friendly Neighborhood Dungeon
The Friendly Neighborhood Nightmare Caller
The Fringe Realms
The Frogbeast Flies No More
The Frost Dragon's Disciple
The Frozen Mist Reaper Titled Duoluo
The Fujoshi Who Was Reborn As A Male Siren
The Fundamentals
The Gaia Project: The World of Terra
The Galactic Salt Road: Albert's Kitchen
The Galaxy's Unrelenting Force
The Gam3
The Gam3: Origin
The Gambit of the Gods
The Gambling Demon King is full of Misfortune
The Game
The Game Master's Adventure
The game of creator
The Game of Dark and Light
The Game of Gaia
The Game of Gods
The Game of Life
The Game Of Life - A new age apocalypse
The Game of Petty Gods
The Game of Spirit
The Game Of The Gods.
The Gamer
The Gamer by Araret
The Gamer - Naruto World
The Gamer - One Piece
The Gamer's core
The Gamer's Godship.
The Game [SCRAPPED]
The Games That Bind Us
The Games We Play
The Games we used to Play
The Game World: Fight For Survival
The Garden
The garden of Eden
The Gatekeeper
The Gates of Yggdrasil
The Gate to Chrono
The Gate to Etheria
The Gate : War of The Worlds
The Gatherer
The Gatriel Decebal Chronicles
The Gaze of One's Desire[Discontinued]
The G.E.M God
The Gemstone Chronicles (Dropped/My First Fic/Leaving up for posterity)
The General Core
The Genesis Experiment
The Genesis System
The Genetically Enhanced
The Genius Manipulator
The Gentle Dragon and the Cruel Fairy (an O.W.S novel)
The Ghost of Freedom
The Ghoul Queen
The Girl And Her Dragon
The Girl and Her Whale(Completed)
The Girl in the Abyss
The Girl Lost in the World of War
The Girl Named Rino
The girl named Seven [completed]
The Girl's Return
The Girl with Scales and a Sword
The Glitch Fiends (rough draft)
The Glory of Life
The Glowing
The Glyph Queen
The Goblin Breeder
The Goblin Paladin
The Goblin's Shadow
The Godborn Chronicles (dropped)
The God Cheese Chase
The GOD Chronicles
The Goddess Chosen; Sword in the Stone
The Goddess of Sins
The Goddess of Void & Space
The Goddess Wanted a Japanese, But Got Me Instead
The God eaters' adventure in a new world
The GOD Eating Dungeon
The God Effect
The God Emperor System
The Godfather Of Time
The God Hunter
The God King APEX
The Godking's Legacy
The Godless One
The Godless One *Hiatus*
The Godling: A Litrpg Saga
The Godly Lawyer
The Godly Protector
The God of Balance
The God of Beastgirls.... and other stuff to.
The God of Gods
The God of Lightning
The God of Lightning and ice.
The God of Lyn
The God of Versailles
The Gods' Arena
The gods chessboard
The Gods' Chosen Few
The God's Game
The Gods Game
The God's Hero
The Gods in The Comment Section
The Gods Must Be jealous!
The Gods of Tergia (Book #1): The Divine Assistant
The God Spirit
The God's Play
The Gods' Play [dropped]
The God's Revenge
The Gods Summons
The Gods we created.
The God Virus
The Golden Age Of Pirates
The Golden Alchemist Midas
The Golden Book (Heavy Crown book 1)
The Golden Gravekeeper 黄金の墓守
The Golden Horde
The Golden Monarch
The Golden Watch Of Hypnosis
The Golem Mancer
The Good Necromancer
The Good Samaritan
The Good Student
The Grandbell Legacy
The Grand eGress
The Grand Experiment's Dick
The grand General -MMORPG
The Grand General - MmoRpg
The Grandmaster of Magic and Alchemy[On Pause]
The Grand Ritual
The Gravekeeper
The Graveyard of the Dungeon God
The Gray
The Gray Knight Chronicles
The Gray Ranger: Unforgiven
The Great Barrier Master
The Great Conqueror
The great Cycle of Life
The Great Demon King AI
The Greatest Adventure Guild
The Greatest Battle Chef
The greatest enchanter
The Greatest Evil
The Greatest Hero
The Great Expedition(Hiatus)
The Great Hero
The Great legend of Fafnir: The Beginning
The Great Necromancer
The Great Nok Ma
The Great Realm
The Great Realm Portal
The Great Sage of Versailless By mb4h
The Great Serpent
The Great Summoner
The Great Sword Tamer
The Great Tower
The Great War
The Greek Apocalypse Volume 1: Sweat, Blood & magic
The Green
The Greensdale Project
The Green Traveler
The Grey Imperium
The Grey Line Between Light and Shadows
The Gta Vrmmo
The Guardian: An unfortunate Wish
The Guardian Apostle
The Guide
The Guide to Understanding Woman.
The Guilty Grunts (Completed)
The gunman's dungeons
The Gunwright
The guy with only one good stat...
The Half-Blood (Currently on Hiatus as I try to figure out where the plot goes...)
The Half-Blood (Dropped)
The Half Interesting Life of A Blood Angel.
The Half Life of Shadows
The Hall: Muraglen Saga
The Hanged Man
The Harbinger of Death (Temporary Hiatus)
The Harbinger Of The End
The Hard Life of a Dungeon Master
The Hardships of a Demonic Monarchy
The Haremest
The Harem King's Big Brother
The Haughty Transmigrator
The Headache Of My Life, But Damn If It Was Not Worth It
The Heart Of A Child
The Heart of a Fool
The heart of Arcturus
The Heart Of Mana
The Heavens Shall Fall
The Helena Chronicles
The Helper - Of Seacoast Row
The Henders Conflict
The Herald
The Heretic Legion
The Heretic that brought God down with him
The Hermit
The hero and demon king getting married!?
The Hero Assassin
The Hero Beside You
The Hero Died and was Revived
The heroes' familiar
The Heroes' Guild
The Heroes' Guild - A LitRPG
The Heroic Adept
The Heroic Lines
The Heroic Tales of Silas Horne
The Hero is a Dungeon Master!?
The Hero of Aerda
The Hero of Destiny is a Girl Now?
The Hero of Farin
The Hero of Imps
The Hero Runs
The Hero's Doppelganger [ONESHOT?]
The Hero's Supplier
The Hero Within
The Hesitant Magical Girl
The Hidden Arbiter of Greed and The White Fox of Immortality
The Hidden Blade
The Hidden Game
The Hidden Lights (The Soul Seer Saga, Book 1)
The Hideous Horde
The High & Mighty
The High School Girl And The Vampires
The History of The Spirit Knight
The hitman summoned as a hero
The hitman summoned as a hero(Computer problem)
The Hitting Zone
The Hive Lord
The Hollow
The Hollow King
The Holy Dark Dragon King's Resting Place
The Homemade Immortal
The HOPE Engine
The Hopeful Man (boy)
The hopeless student in another world
The Horde
The horseman, death
The Horseman's Culling
The Howl of the Marsican Wolf
The Human Conduit
The Human God
The Humanity Initiative
The Human Soul
The Human Traitor
The Humble Divine [hiatus]
The humming swordsman
The Hundreds
The hungriest little monster
The Hungry Dungeon
The Hungry Jaws
The Hunter
The Hunter and his Companion
The Hunter's Alliance
The Huntress and the Demon
The Hybrid
The Hypocrites Advice Club
The Ice Empress's Husband is The Third Lord a Stubborn Hot blooded Gardner
The Ice Fairy
The Idle Masters of the World
The Idle System
The Illuminating Heroes
The Immortal
The Immortal Chimera
The Immortal Curse
The Immortal Dream
The Immortal Dungeon
The Immortal Emperor
The Immortal Epic
The Immortal King
The Immortal Magus
The Immortal Mercenary King (Proof of Concept only/Not Full Story)
The Immortal Ninja of the Elemental Nations
The Immortals.
The Immortal Scientist
The Immortal's Dice
The Immortals' Poison
The Immortal Supreme
The immortal that ran away from home
The Immortal Witness
The Impact and The Invocation
The Impossibility
The Impossible Fate That Leads To A God Of A New World
The Impossible Realms
The Incipient Path to Demesne
The Incompetent's Odyssey
The Incompetents Odyssey
The Incredibly Lazy and Extremely Depressed Mr. Benedict In Another World
The Incursion - Rise of a Magus
The Independent Existence By Ligius
The Infamous Creation
The Infamous Heroes of Exile Book 1: The Parallel Frontier of Reality
The Infected Progressive
The Infinity Dungeon
The Infinity Guild
The Infinity Islands
The Infinity Project
The Inheritance System
The Inheritor
The Injured
The Innovator
The introduction of magic
The Inventor of Magic
The Invincible Hero
The Invincible Monster
The Iridis Experiment
The Iron Teeth: A Goblin's Tale
The Iron Veil
The Irregular at the Otherworld
The Irregular Esper Knight
Their Rusted Hearts
The Isekai
The Island of Hope by A. Livadny
The Island of Wolves
The Isolated Mage
The Isshaniad
The Ivory Tower
The Jeweler, Dawn
The Jianghu
The JJ Chronicles
The Joke's Son
The Journal : Gliese 581C
The Journal of Alexis Greco
The Journal of a Slime Researcher
The Journey
The Journey of a Lazy Magician
The Journey of a Little Spirit[Dropped]
The Journey of an Apprentice
The Journey of a Scarecrow
The Journey of a Serpent
The Journey of a Yuri Cat Girl in a Fantasy Futuristic Universe
The Journey of a Yuri Cat Girl in a Fantasy World
The Journey of a Yuri Cat Girl in a Futuristic Fantasy Universe
The Journey of the Ancients
The Journey Of The Fool
The Journey of The Three Immortals
The Journey to Godhood: A Madman's Dream
The Journey Towards Stardom
The Juggernaut
The Keeper
The Keeper of the Longhouse
The Keepers
The Kerberusian
The Key Master - Autobiography
The Key: Nakiami
The Key of the Ancient
The Key of the Ancients
The Kind Devil
The Kindest Human
The kind of God I'll become
The Kind Sect Master
The Kingdom
The Kingdom of Fivewalls
The Kingdom of One
The Kingdom of One (Hiatus)
The Kingdom of Stone
The Kingdom of the Dead
The Kingdom Stone: A LitRPG Kingdom Building Serial
The Kingdom Stone: A LitRPG Serial
The Kingdom through the Swamp
The King Is Back
The Kingly Leader
The King Named Jack
The King of Avarice
The King Of Crime.
The king of demonic beasts [DROPPED]
The King of Desecration
The King of Desire
The King of Desires
The King of Frost
The King of God Slayers
The King of Kings and Magician of Magicians
The King of Phantoms
The King Of Sloth
The King of the Earth
The King Of The Forest
The King of the Jungle: Rise of the Basin Fortress
The King's Brother
The King's Favour
The Kings play a Game?
The Kitten Who Conquered an Empire
The Kitty Litter (LitRPG)
The Knights of Z
The Kraeton Chronicles
The L10Ns
The Labyrinth
The Lag (The Game Master: Book #1)
The Land: Founding
The Land of Gods
The Lands of Puppets
The Landvaettir
The Last 100
The Last Boss
The Last Crusade Wars - Book Despair
The Last Death Mage
The Last Descendant Of The Dragon Clan
The Last Dragoon
The Last Druid
The last Dungeon
The Last Earthling
The Last Emperor of Nature
The Last Evil
The Last Fire Mage In A Frozen World
The Last Force Master
The Last God (Excerpt)
The Last God (Online)
The Last Golem
The Last Guild
The Last Guild: Remastered
The Last Horcrux
The Last Human Space Admiral
The Last Immortal
The Last Ki Master: The New World
The Last King
The Last Lie
The Last Living Necromancer
The Last Necromancer
The Last Noble
The Last of the Tiger Clan Ninja
The Last One
The Last Online
The Last Philosopher
The Last Refugee
The Last Science
The Last Soul
The Last True Demon
The Last Walker
The Last Wraith
The Last Zeus: Book 1- The Beginning
The Laughing Dungeon
The Law of Averages
The Laziest Strength Build
The Lazy Demon
The lazy dungeon's log
The Lazy Edgy Protagonist Is Lazy and Edgy Today As Well
The Lazy Man's Odyssey
The Lazy Potato
The Legacy of a Pirate
The Legacy of Athena and Hermes: The Lightning Thief
The Legacy of Atlantis' (On hiatus until Summer '16)
The Legacy of Starlight
The Legacy of the Assassin [DROPPED]
The Legacy of the Monkey King
The Legacy Of The White Dragon (Dropped)
The Legend
The Legendary Aegis
The Legendary Alchemist
The Legendary All Jobs Book
The Legendary Bard
The Legendary Dragon Master
The legendary dungeons history(dropped)
The Legendary duo
The Legendary Gamer
The Legendary Gamer (LegendaryFictionist)
The Legendary Knights(Discontinued)
The Legendary Moonlight Serial-Killer
The Legendary Path
The legendary sword saint
The legendary tamer
The legend of Aila (dropped fiction)
The Legend Of Drog
The Legend of JaWal by WarWalker
The legend of kai uchiha
The Legend Of Lin Ti
The Legend Of Michael
The legend of Navy Queen
The legend of Paul J. Raizer
The Legend of Randidly Ghosthound
The Legend Of Rave [ Hiatus ]
The Legend of Rei
The Legend of Sagen Vent
The Legend of Someone by Dyncharoth
The Legend Of Star Born
The Legend of Talon Man
The Legend Of The Blizzard King
The Legend of the Dark Chronomancer
The Legend of The Demon Prince
The Legend of the Engineer
The Legend Of The Insanely Overpowered Mage
The Legend Of The Kobolt
The Legend of the Legendary Xu Xian
The Legend of the Overlord
The Legend of the past wants to live a different life
The Legend of the [Place Holder]
The Legend of the Shadow Wooper
The legend of the son of the legendary hero.
The legend of the sun guild.
The Legends of Col: Red Tide
The Legends of the Spirits
The legend who ran faster than the gods
The Legion of Nothing
The Lethargic Man Full of Energy
The Leveling Cultivator
The Liar Face Demon (Legendary Wizard Saint)
The Library
The Lich beneath the city
The Lich's Dungeon
The Lies of an Elfin Queen
The Lies They Told Me: Short stories from my life
The Lie You Told Me Back When Were Kids
The Life After Death
The Life And Death Of Me Autobiography
The Life and Times of Daniel West
The Life: Illusion
The life in Asgard.
The life of a bandit.
The life of a butler in another world
The Life of a Dragon
The life of a little orphan tortoise
The Life of a Lost Lamb
The life of a merchant in vrmmo
The life of a minstrel
The life of an Apache Attack Helicopter in another world
The life of an arrow that turned into a boy
The Life of an Author
The Life of an Undercover Conqueror at Specialized High School
The Life of a Sadist~Torture
The Life of a SLAVE
The life of a Soldier
The Life of Demon Empress Siamara
The Life of Fae
The life of fantasy
The life of Jeyvan Avorian
The life of Leo a Mecha Pilot
The Life of the Phoenix Titan
The life of the undying Empress
The Life of Yue
The Life System [Hiatus/Slow Update]
The Light Bringer
The Light Knight
The Light Maiden's Mark
The Lightning Emperor
The Lightning Warrior
The Light We Saw That Day
The Limbo Project
The Limits of Limitless
The Lineage Saga
The line between heroism and tyranny
The Lion Chooses
The Lions Pride
The Lipaks Way
The Little Girl on The Bike- Mystery Contest Short Story WINNER
The Little Huntsman
The Living Cheat In A Unknown World
The Logs of Nix Regina
The Lone Devil
The lone (In)Sane Person amidst a sea of (in)sanity
The Lonely Adventurer by Iskritor
The Lonely Apocalypse
The Lonely Astronaut
The lonely black hole
The Lonely Death God Wants To Live.
The Lonely End ( Abandoned)
The Lonely Wanderer
The Loner
The Loner?
The Loner Otaku NEET Girl Becomes a Hero!(?)
The Lone Wanderer (Old version)
The longest journey
The Long Night
The Long Road
The Long Song
The Lord of All Things.
The Lord of Staves
The Lord of the void
The Lord of Time - By Wiz
The Lord of War [Dropped]
The Lord of Wind's Crucible
The Lost
The lost Chronicles of PANGAEA:Apocalypse
The Lost Chthonian
The Lost Crest
The Lost Day
The Lost House
The Lost Knight and The Wandering Goddess
The Lost Legacy
The Lost Little Lizard
The Lost Magician
The Lost Ones
The Lost Redeemer
The lost Seraph.
The Lost Soul
The Lost Sun by Grisia
The Lost Twins Of Regorovia Kingdom
The love of Life and Death
The Luckiest Knight
The Lucky Clover
The Lucky One
The Machine Saga Vol. 2
The Maddest Scientist
The Mad Hatter
The Mad King Who Can See The Future
The Madman's Clock
The Mad One
The Mad Prince
The Mad Scientist's Wife
The Mad Soul
The Mage Acquired a Wife
The Mage Hero
The Mage's Crown