Group RoyalRoadL

Group Aliases

  • RoyalRoadL

Series

=
---
0 Damage Assassin
+1
1000-Hit KO
1000 Lives Relived
100 Luck and the Dragon Tamer Skill!
100 Ways to Make Money in a Fantasy World
100 Words
10k Years Silent Cultivation
12 Zodiac!!
139 Years to the End of the World
13.Ai
13 Clans of Gods: Book One [The God of Void]
13 Seconds
13th Soul- Book 1 The God Slayer
#199
1) DECK: Annoying Dreams
#1 Shadow
1 Vs Tthe World
200X300
2040: Queen of Nowhere
2040: Reconnection
2100
2278
2332: Fleeing the Arrakis
23 Pangbourne Place
24
243 Wanderers
24 The Conspiracy
2.5 D adventure
299 441 Yen
2'n Aloysius
2Nd Chance: The Beginning
2 Worlds
3.0.1
3 Bastards and a Red Slipper Demon Queen
3D/2D: I Got Sent to a Fantasy World and Turned into an Anime Character?!
3 Hearts
40 Thousand Reasons
46 Year Old Syndrome
48 Hours
49 And One Hero.
5 Dragon Emperor
72 Hours
777
7 Desire 7 Death , a way you chose me
7 Dragons and Princess
7th Chronicle: Utopian Road
8th Deadly Sin
9001: A Dungeon Ship Odyssey
9001: The resurrection of the Dominion
99 Dungeons: The Beast Lord
9 Circles of Hell
9 Levels of Hell - GameLit
9 Lives
A 3% Chance for Glory
A Ai`S Adventure In A Different World In Space
A android,a ghost ,a immortal,a necromancer and a council in a bar
Aaron, A Shadow Monster
Aatrox, A God King in a Modern World.
A bad deal.
A Bag Of Bones
Abandon all hope by Darkmatter
[Abandoned]
Abandoned Card System
***ABANDONED***It Was the Best of Slimes, It Was the Worst of Slimes
Abandoned: The Story About Ryu The Banished God
Abandoning All Hope
A Bard's Song: Lore
A Bard's Tale
A Battle of Eyes Against the Gods
Abduction Chronicles: GENESIS
A Beautiful Twilight
A Beginner's Guide to Napping, Sunbathing, and Slaughtering Your Prey
Aberrant: Unbound Soul
Ability
Ability to make a kingdom? Let's make a fast food restaurant!
A Billion Players
A Binding Soul
A Bit of Everything
A Black Man Reborn in Jiang Hu!
A Blacksmith's Tale. A LitRPG Story
A Blade's Shadow
A Blank Tale
A Blazing Journey: A New Beginning
A blend of everything
A Blighted World
A Blind Descent
A Blond Ray of Sunshine
A Bloody Game
A Bloody Mess: An abnormal story
Abnormal
Abnormal Boy Enters A New World
Abnormal Days
Abnormal Tamer
A Boku No Hero fiction
Abominable King
Abomination
A book fanatic's Journey through a Fantasy World
A Book to Remember
A bored boy looking for reason
A Bored Goblin's Journey to Pass Time
A Bored Immortal's Adventure with Reincarnation
A Bored Passerby With Some Cheats
A bored story (Hiatus)
A "boring" Game.
Above All
Above Heavens I Stand
Above the Fog
Above the Heavens
A Boy's Wish
A Brand New Day
A brave new, Scary world
A Breath of Fresh Air
A Broken Doll and her lost Soul
A Broken Kingdom
A Broken World
A Broken World [Dropped Pending Rewrite]
A Broken World [Rewrite]
Absalom's Fate (The Everlands Book 1)
Abscondere
Absolute Control
Absolute Divinity (JJBA)
Absolute Knowledge
Absolute Order
Absolute Power
Absolute Power of the Imagination
Absolute Shopping Addict
Absolution
Absorbed
Absurd Mage in Another World
A Bunnerfly in the Desert - A Kammiverse Story
A Bygone Era
Abyssal Fortress girl in another world
Abyssal King
Abyss Core
Abyssmal Downpour
Abyss System
Abyss "tomb of the gods"
Abyssus
Acacia Chronicle
Acadamia of Heroes
Academy of Heroes (The Murder of Innocence)
Academy Saint
Acadia: A LitRPG Adventure
A Caregiver's Last Lesson
A Castle and a Tomb
A Castle in a Teacup
Accidental Adoption
Accidental dungeon
Accidental God
Accidental Love Destined Betrayal
Accidentally Blessed by a Goddess Before Reincarnating
Accidental Merlin
Accidental Orc
Accidental summon
Accidental Time God
Accidential dungeon
Acclimation
A Celestial's Wrath
A Century Later
Ace of all Trades
Ace of Demons
A chance
A Chance Again
A Change In The Same World
A Cheap, OP Brawler
A Cheap, OP Brawler (Currently on Hiatus)
A Cheat Cultivation Level
A Child of Moon and Sun
A Chitinous Journey
A Chuunibyou's Life in Another World!
A City Stranded Cowboy's Robot Mercy Killing Business
A Civil Minotaur In An Uncivilized World
A Cliché Multiverse Story
A Cliché Reincarnation
A Clone of Arth
A Collection Of Ideas. True's Oneshots.
A Collection of Tales
A Collection of the CRAZY STORYTELLER
A Collection of Thoughts
Acolyte
Acolyte: The Emerald Gates
A Compendium Of Realities
A Compendium of Useless Powers
A complicated man with a simple dream
A Conqueror's Tale
A Conquest of the Stars: The Heart's Anguish
A Convenient Fiction
Acousat
Across the border
Across the Realms
Across the Realms [Dropped]
Action, Adventure, Videogame
A Cultivation Realm Dungeon
A Cultivation Story
A Cultivator in a Magic Filled World
A Cup of Moondust
A Curious Case of Mobs Extra
A curious cat's life in a new world
A Curious World
A Cursed Life.
A cute duckling in an ugly world
A Cute Woman and Her Clingy Husband
A Daemon's Gamble
Adamant Doom
Adamantine Dragon in the Crystal World
Adamantine Heart
Adam is the Protagonist
Adam's coin
Adam: The Archer
A Dance of Light and Shadow
A Dance Of Poison And Curses
Adapt: The Scourge Wars Book 2
A Dark and Dangerous Place
A Darkened Realm
A Dark God In A Darker Multiverse
A Dark God In An Otherwise Godless Multiverse
A Dark Prophecy of the Last Age: From One War Torn World to Another
A Dark Road
A Day With The Cross Dimensional Traveling Truck Driver
A Dead God's Wish
A Degenerates Book for Survival
Adelaide
A Demon Between Worlds
A Demonic Conquest
A Demon Lord NEED HELP!
A Demon lord's dilemma
A Demon Lord's Virtual [Magic Life]
A Demon, Probably
A Demons Evolution
A Demons Evolution (Hiatus)
A Demon's Gift
A Demon's Ordinary Survival Story
A Demon's Tail
A Demon Within
Adeptaverse
Adeptaverse - Origins Of Altara
Adeptaverse - The Holy Calamity
A Deranged World
A Descendant To God
A Dessert of Dreams
A Devil's Child
A Diary of Tressure
A Different Kind of God
A Different Kind Of Hero
A Different kind of Hero (Marvel)
A Different Kind of Hero (Will Be Revised)
A Different Kind Of Journey
A different point of view
A Different World Where The Demons Are Good
A Disciple from Beginning, A Master to End
A Dissonance in Harmony
A Ditto's Tale
A Diver's Tale
Admin Playground
Admin Playground - leave it be.
Admin Test
A Dog's Loyalty
Adonis
Adorne: (A LITRPG adventure)
A Dose of Nonsense
A Draconic Insurgency
A Draconic Odyssey
A Dragon Among The Stars
A dragon familar
A Dragon Gnawing Its Tail
A Dragon Idol's Reincarnation Tale
A Dragon In human Skin
A Dragonoid's Tale
A Dragon's Curiosity
A Dragon's Dungeon
A Dragon's Treasure: A Reincarnation Story
A Dragon With Fur
A D-rank Adventurer's Bizarre Reincarnation
A D-rank Adventurer's Bizzare Reincarnation
A Drastic Step
A Dream
A Dream to the Summit
Adrift
Adrift To Stranger Land
A Dryad isn't just firewood
A Dryflame Child's Life (Rewriting)
ADT - Another Dimension Travel
A Dulled Blade
A Dumb Girl in a Cultivation World
A Dungeon Core
A dungeon core story: Magic with a hint of Science
A Dungeon in Space
A Dungeon of Fate and Fae
A Dungeon Of Fire And Death ( english ) Eine MI des Feuers und Todes ( german )
A Dungeon's Journey
A Dungeon's life
A Dungeons Quest
A Dungeon Tested
Advent
Advent of an Assassin
Advent of a New World!
Advent of the Apostles
Advent of the Ascended [Dropped]
Advent Of The Median
Advent of the Skeleton King
Advent: Red Mage
Advent Steel
Adventured away
Adventure From A Bard's Perspective
Adventure In A Foreign World - Legacy of The Chosen One
Adventure of Adventures
Adventure of a system supported gamer
Adventure of Chance
Adventure of Lara
Adventure of Luke
Adventure of The Eternal Brothers
Adventure Online
Adventure Quest: Guardians of The Night Sky
Adventurer
Adventurer Academy: Greyblood
Adventurer Hearth's Guide to Monster Taming
Adventurer - Sunrise Over Sunset
Adventures in amnesia
Adventures in Atalok
Adventures in Magic
Adventures in Mim
Adventures in Planus
Adventures in Red: Gunslinger's Follower
Adventures in the Pirate Continent
Adventures in Wonderland
Adventure? Slime? Slimeventure? Yeah, something like that.
Adventures of a Fake Monk
Adventures of A God!
Adventures of Alex Blackwell
Adventures of an avid gamer
Adventures of an Old Dreamer
Adventures of a Reluctant Pacifistic Monster
Adventures of a young Zuma
Adventures of Lord Genesis
Adventures of one dude with an afro
Adventures of Percy Jackson in the MCU
Adventures of Ragnos
Adventures of Shadow and Garb
Adventures of Stephen Silworth
Adventures of the Bearmon Trainer
Adventures of the Blasted Marksman [Rewrite]
Adventures of the First Being
Adventures of the Goldthirst Company
Adventures of the moon
Adventures Of Truck-san
Adventures of Vee
Adventures of Zik Sev
Adventures on Patriam: Wolves and Men
Adventures on Terra: Beginning
Adventures With a Reincarnated Bush
Adventure to the Stars
Adventuring in Another World
Adversary
Advice for Authors
*A Dwarf's Story*
A Dying World [DROPPED]
Aefell Online
Aegis
--Aegis--
Aegis Of The Gods
Aelin (title may change)
Aelios Online
Aenthar
AEO Alt Earth Online
Aeon Chronicles: The Frozen Calamity
Aeon Genesis: The Sin of Innocence
Aeonica
Aerid
Aerid: Tales Of The Academy
Aeromancer
Aeroth: The Arrival of the Beasts
Aesthetic of a Female Rogue
Aestia Valley
Aestral Online
Aeterna
Aeternalis
Aeterna Saga, Volume 1: Walking With Giants
Aether
Aether Dragon
Aether Gate Online: Slayer (A LitRPG Saga)
Aether Hex and the shards of the demon king.
Aetherial Adventures
Aethernea
Aether Online
Aetherworld
Ætla Verǫld
Aevitas — I am not an NPC [R]
A fairy tale for the nephilim
A Fantasy in Time
A Fantasy of Everglow
A Farmer's Strength
A Fate Set in Stone (On Hold)
A Female Rogue's Adventure Through Two Worlds
A Female's Take on The World of Cultivation
A festering world
Affairs of the Soul
A Fiery VRMMORPG adventure
A Fire
A Flower in Death's Embrace
A Flower underneath a Willow
A Fool fooling around in another world
*A Fool's Errand*
A Forbidden Contract
A Forced Hero
A Forest Dungeon
A Forgemaster Of Wayland
A forgotten ruler
A Forgotten Soul
A Forgotten Specter
A Forgotten Vampire
A Former Hero's Journey: I just want to live peacefully!
A Fox at Heart
A Fox in the Woods
A Fox's System
A Fragmented Mind
A Friendly Shadow
A Frozen Conquest!
After All
After Apocalypse: Silver Wind
After Days Chronicles: A Cabin By A Lake And The Things Beyond.
After Death
After death?
Afterdoom | The Post-Postapocalypse
Afterdoom | The Post-Postapocalypse (Complete~)
After Eons
After I Lost to the Demon King
After Kreation: A Widower's Tale
Afterlife
After Life
After Life?
After-Life
Afterlife: A Gamelit Tower Story
Afterlife Hospital
Afterlife Industries: The Devil's Day Job
Afterlife - Next World's Auction House
Afterlife Online
Afterlife Online: Reboot
After Megiddo
After Megiddo: Hell's Pursuit
After Megiddo: The Book of Gideon
After Megiddo: Underrealm
After Moses
Aftershocks
After the Fall and Other Stories
After the Fall. (Book 1 of the Shardfall Saga)
After the Game Over
After The Mountains Are Flattened
After the universe exploded, I became a Dungeon Master.
AfterWorld
After Worlds End
A Future Destroyed - A Post-Modern Fantasy LitRPG
Again
Again?!!
Again and again
Again [On hold]
Against all the Odds(hiatus)
Against My Fate
Against My Will
Against The Elements
Against the heavens.
Against the heavens. *Hiatus for trial*
Against the heavens. *Rework in release.*
Against the Heaven's Will
Against the Nine Great Heavens
Against the Sky
Against the World. Chronicles of melancholy
Againts all the worlds
A Galactic Dictator's Adventures into a Magical World!
A Galaxy, Alive
A Game For Monsters
A Game Of Chess
A Game of Dancing Pieces
A Game of Hedrons
A Game of Life
A Game of Unknown Origins
A Game of Villains
A Gamer But I Also A Realist That Do Not Believe Anything That Not Disprove
Agartha (hiatus)
A Gatored Community
Age Is Just a Number.
Ageless Aneurin
A Gem To Be Remembered [bl]
A generic love story
A generic love story: disturbance
A genius of none
A Gentleman's Curse
A Gentleman's Curse: Arc 2
Agent Lightning: Operation Angel Arms
Agent of the Alternates
Agent of the Realm?
Agents of Dawn
Agents of the Lord
Age of Aggression
Age of Avarice
Age of Champions
Age of Change
Age of Destruction *dropped*
Age of Gods
Age of Gods - A VRMMO Story [Dropped For Now]
Age of Gods Online
Age of Heroes
Age of Heroes: Novus Gaia
Age of Immortal
Age of Others
Age of Revolution
Age of Swordsmen
Age of Swordsmen Online
Age of Teras: Monster Evolution
Age of the Dungeon Hunters
Age of Victoria
Ages Online
Aggro Healer
Aghori
A Ghost Life
A Ghoul's Legend
A Giant Among Dragons
A Girl and her Goat
A Girl's, Unusual Existence
A Gladiator's New World [HIATUS]
A Glass Window
A Glimmer in the Dark
Agnes of Raegma
A Goblin's Blade (dropped)
A Goblin's Evolution
A God in a Xianxia world
A God In The Bay (Worm/Massive Crossover) (Worm Quest)
A God's Chosen
A god's crime against humanity
A God's Freedom
A God's Fun Time
A God's Game
A god's Perspective
A God's Pub
A God's Purpose
A Golem And Puppets Adventure
AGON: Trail by Champion
A Good Bargain [HIATUS]
A Good Man
A Good Night's Rest
Agordos
Agorɔ
A Gray and Grey world
Agros de Mortis
A guide to hero killing
A Guide To Immortality (discontinued)
A Gun in a Dungeon
A Gun is the Strongest Weapon in a Fantasy World!
A Guy, A Latte and Status Screen.
A Hand-Woven Universe
A Hard Game (Dropped)
Ahead of the Patch
A Healer's Gift, An Adventurer's Heart
A healthy mind in a healthy body
A Heart of Ice (hiatus)
A Hermit's Life for Me
A Hero Past the 25th
A Hero Past the 25th: Old Empire
A Hero Past the 25th: Paradise Lost
A Hero Returns
A Hero Returns (On Hiatus)
A Hero's Brother
A Hero's Common Sense
A Hero's Legacy
A Hero's New Beginning, Again...
A Hero's War
A Hero to Only One. (Completed)
A Hero turned Succubus's Tale
Ahh so it's another dungeon story with a long name
A Hidden World
A High God's Reincarnation
A History Buff Brought to Another World
A Horcrux's Fate
A Hunter's New Home
A Hunter's Wings [Rewrite]
A Hunt For Crows
A.I.
A.I. Actual Intelligence
AI Immortal God Soul
Aincrad Realized
Ain't A Hero
Ain't no Rest for the Wicked
Airant
Airbound
AI: Revolution
Airi
Airi in a Thousand Worlds
Airium - Beta key
AI's Champion
Aivuez: The One Being Brought to Lullaby
A Jaded Life
A Job for a Wendigo
A Journey Away - Book One of The Eternal Flame
A Journey Into Mario World
A Journey of an ordinary girl in a fantasy world
A Journey of Black and Red
A Journey of Chaos and Glory
A Journey Through Frost and Snow
A Journey Through the Worlds.
A journey to the beginning
A Journey With Gods and Monsters
A Jump Into Fantasy
Aka
Akashic
AkaTsuki: Book One [The Heart of A Samurai]
Akhand : The Demon Emperor
A Kid and His Slime
Akif Kas - Champion of the Arena
A Killer Reborn
A Kingdom of Power, of Courage, and of Wisdom
A King of His Own
A King of Old
A King's Bargain (Legend of Tal #1)
A King's Regret - Ravenchild
A Knight Of Humanity
A Knight's Redo (Completed)
A Knight's Will
Akuma Karu
Akuma no seifuku no fukushū?
Alaric Castle
ALARIC CASTLE: Becoming the Best Boss Level
A Lasting Fury By Replica1
A lazy king
A Lazy Programmer
Albert's Summer
Albion Live
Alceria
Alctuz Arena
Aldemoor
Aldenia: The Lost
Aldernoh
Alea Ludo
A Legendary Tale: From rags to divinity!!!
A Legend Reborn
Aleri The Return
Alexander Nightmare
Alfarome: Volper
Alfegenia-Inline
Aliad [Dropped]
Aliad - Tale of Zed [Dropped]
Alice
Alice: Conquering Nightmare
Alice Devil Gift
Alice In Madness
Alice in Magic Land
Alice in Magic Land [UNREVISED]
Alice's Saga of Fire and Blood
Alice The Roaming Dungeon
Alien Abduction: A LitRPG
Alien Me
ALIEN: Otherworld
Aliens in a fantasy world (AvP fanfic)
Aliens! Tech! War! OH YES!!
Aliens vs The Elvish Empire
Alien: Tribulation
Alien Witch
A life of excitement
A Life of Terror.
A Life Rewritten
A Life's Journey
A Life's Lie
A Lifetime Promise
Alistair's Great and Powerful Startup Dungeon
Alistair's Legacy
A Little Bit OF A Silverlining HIATUS
A Little Bit Of Motivation
A little bit of Villainy
A little case of a supernatural affair
A little Kitty's journey though a random world
A Little Sister'S All I Need | 我只需要一個小妹妹
Alive
Alive ?
Alive?
A-Live AI
Alive, once again
A "Living" Weapon Named Death
All
All Alone with You
Alland
All Because of a Serum
All Because of a Serum: Batch 1
All Days Shall Be Numbered ; A LitRPG
All Encompassing
All into Agility
Allocation
All of The Angels
All-Powerful
All-seeing
All's Fair In Love&War
All Songs: A Hero Past the 25th
All Stats Random
All systems rise to power.
All Things Must End
All Time Greatest Genius
All Trades Book 1: Master of None
Alluring Smile (Yāoráo De Wéixiào)
All World Online
Almagear
Almagear (V2)
Almavé
Almighty Dung
Almighty Dung [Dropped]
Almighty Hunter
Almighty System
Almisha's Journey
Almost Grimm
Alone
A Lone Automaton's Journey To Find Its Operator
A Lonely Girl's Journey to Immortality
Alone No More
A Loner's Calling
Along for the Ride
A long slumber.
A loose Page
A Lord of Death
A Lost Man
A Lost Necromancer's Saga
A Lotus Of Death
A Love at Stake
A Lover Siblings in Royal Road!
A love so divine!
A love to kill!
Alpha
Alpha Armageddon
Alpha - Book 1 in the Jaro Trilogy
Alphas & Omegas [Dropped]
Alpha Squad - Vecto: Vengeance
Alt Atelier
Alteratio
Alteration
Alterea: The JoaT
Alter: Eclipse| The Chronicles of Gacaea | Book 1
Altered Realms: Ascension [completed] - Book 1 - A LitRPG series
Altered Realms Book 1: Inauguration
Altered Realms: Book 2 - Uprising - A LitRPG series
Altered Tales
Alterlife
Alternate Dreams
Alternate Earth Alternate timeline (DC)
Alternate World Online
Alternative Berseria The X (アルタナティブ・べうセリア・ザ・クロス)
Alternative Reality Vol. 1
[Alternative Recode]
Alternative: To Love–Ru
Alter's Aburd Escapades!
Alter Tactics
Altrea: New sights from another world
Alviona (undergoing Rewrite).
Always and Forever
Always Name Your Tools
Alzholme
A Magic Sniper in Another World [Hiatus]
A Magus Among Cultivators
A Maiden's Frozen Heart
A Maiden's Strange Voyage
A Mailman as a Superhero
A Major in Necromancy
Amalus
Aman
A Man and His Greatsword
A Man and His Gun
A Man and the Sea
A Man At Arms
A Mao's Tale
Amaron Online
A marvel rise
A Maze of Glass
Amazing Cleavage: The Adventures of a Battle Axe
Ambassadors to another world
Amber
Amber Silverblood
Amber Silverblood: Silverpack
Amber the Goddess of Time
Ambidextrous
Ambiguous
Ambition
Ambitions of an Immortal
Ambot sa langaw pilay idad sa ok-ok!
Ambush (DarkForce: A GameLit Saga - Book 1)
A mean Demon Queen Kidnapped me!
A Meaningless Hero
A Mediocre Supreme Cultivator
A Melody of Fire and Lightning
Amending of the 'Evil' Pair.
A Merchants Tale
A Mere Fate of Mine
America In Another World
A Mermaid's Responsibility
A Meta-Human In Another World
A Metaverse Dungeon - Foodie's Enigma
Amethyst Phoenix
Am I a capture target in a otome game?
Am i a goddess? A devil? No i am a lizard
Am I a goddess? A devil? No, I am a lizard
Am I a Goddess now?
Amidst the Final Sky
A Mildly Odd Reality Breaker
Am i spoiled?
Am I The Creator Or The Destroyer?
Am I The Only One Who Is Not Forced to Migrate Across Worlds....?
Amnesiac
A Modern Day Demon King
A Monarch's Quest
Among Demons and Gods
Among Giants
Among Monsters and Men
Amongst The Sky
Amongst the Stars
Among the Dead
Among The Stars
Among the tear soaked flowers
A Monster's Jaunt
A Most Unfortunate Summoning
A Mother's Bond Taken After Death
A moth of winter - A Kammi Kettu fan story
A Mouse in the Circuitry - A Kammi Kettu Story
Amulet of Infinity
Amusement Park
A Music Prodigy
An Abnormal Kobold
An Above Average Girl In A Fantasy World
An Academy for Villains
Anachronism
An Advance in Time
An adventurers tale
An Afterlife Odyssey
An AI in Eden
An A.I Is Such A Cheat In The Martial World!
An Aircraft Carrier in a Fantasy World
An Alien in Wonderland
Analytic System in Another World
Analyze, Create, Control In Another World
An Animal in Sheep's Clothing
An Anime Weeaboo in a Different World [Hiatus]
An Anthology
An Apex Supreme Master Running A Library Filled With System
An arachnids way to Niflheim [HIATUS]
Anaraknakrium: The Cursid
Anarchy
Anarchy's Dungeon
An Argonaut's Odyssey
An Aria of Fire and Blood - Volume 1 - Kismet
An Artificer's Ambition
Anathema of the Eldritch
Anathum: Quest for the End
A Nation of Riflemen
An Atomic Choice (A Working Title)
A Naturalists Dungeon
An Atypical dungeon
An author's massacre; the sudden appearance of the world, and its immediate cry
An author's new view
An average adventurer.
An Average Joe Is the MC
An Average Zombie's Path of Evolution
Ancestor, Wake Up! (Xianxia novel)
Ancestry: The 1/64 Orc, The Quest and The Status Screen.
Anchore
Anchored
Anchore (Re-Write in Progress)
Ancient Adventurer Return
Ancientblood
Ancient Blood Mage
Ancient Cultivator in Modern World
Ancient Dragon of Chaos [Spanish]
Ancient Earth
Ancient Fangs: Birth
Ancient Fangs: HOUSE AMULIUS (Book 2)
Ancient Return
Ancient Ruler [ XIANXIA ]
Ancients
Ancient Sins
Ancient Sovereign
Ancient World
And Dungeon Makes Three
And far was the walk.
... And My Skillet
Andraste
Andraste's Chevalier
Andrea's Tale
Andromeda's Tears
And So We Leisurely Walk
And then I made my own world
And Then You Left
And the world breaks
And Thus, We Hoped
Andur's Oneshot collection
And You Thought Your World Was Harsh!
A Necromancer's Village
An Edgy Tale Of An Edgy Teen
A Needed New Start
An Egotistical Heretic's Reincarnation Doctrine
An Eldritch Tale: the Archwizard's Tome
An Elven Druid's First Adventure
An Empire of Fire and Magic (The Chronicles of Pavel Maveth - Book Two)
An Empire of Shadows
An Empire Reborn (A Rebirth of Empire: Book 1)
An Empire Reborn (A Rebirth of Empire Series: Book 1)
An Empires Rising
An Enchanter's Tale
An Ent-Like Existence
A Nerd's Wet Dream Come True (Tossing an OC into Marvel)
A Nerd's Wet Dream Come True (Tossing an OC into Marvel) V2.
A Nerd's Wuxia Tales
An Eternity Gone By, To Learn To Live
An Evil Hero
An Evil Justice
A New Adventure
A New Beginning By Aerebes
A new Breath Online
A New Breed of Pirate
A New Breed of Pirate: A VRMMO Tale
A New Continent
A New Goddess
A New King
A new leaf (Old version)
A new life
A new life in a new world.
A new life of a boy (working title)
A New Life Through The Eyes Of Kanto: An Autobiography
A New life with the choice of destruction or creation in a new world(hiatus)
A New Life (zod119)
A New Line Through The Lives Of Kanto
A New Loli Life On A Fantasy World!
A New Path
A New Path, Chosen freely
A New Story
A new world
A new world a new Chance(DROPPED)
A New World: Eve
A New World? I'll Do What I Want!
A New World To Call Home, As Sloths Representative
A new zombie apocalypse
An Excuse for Space Battles
An Exploration of Vulnerabilities
An Extra-Ordinary Story about Ordinary People
Angel and Wolf: Chronicles
Angel and Wolf: The Fury
Angelborn
Angelic adventures
Angelica the Techno Ghoul
Angelic Knight Of The Mighty Zealot
Angelic Quest
Angel of Death
Angel's Ladder
Angel's Redemption (BL)
Angel's Song: Requiem of the Dreams
Angels Without Wings
Anima
Animated
Anime Apocalypse
Anime Clichés 101
AnimeCon Harem
Anime Dungeon
Anime powers in the Naruto world
Anime wheel of fortune
Anime World?
Anime Worlds System
An Immortals' Interaction with Modern Technology.
An Immortal Tale
Animus
Animus Smith
Animus Storm
An Inconvenient Flame
An Indomitable's Odyssey
A ninja transported to another world
An innocent storm
An Interesting Journey
An Introduction to Being a Goddess
An islander's Meta-journey
An Minecraft Adventure
Anna'dalia
Annals of the Snow Prince
Annihilation's Impact
Annihilation System
ANNO DOMINI ~Allium~
ANNO DOMINI ~Allium~ [Beta version]
Anno Iudicio
Annotated By Sins, Magic Academy
An NPC's Path: The Dead Rogue by Pavel Kornev
Annwyn Online
A Nobody Special
An Ode to the Birds
Anoikis
Anointed in Blood
An Old Cultivation Record
An Old Man's Journey Vol 1 & 2
An old mans tale!
An Old Villian's Tale
Anomaly
ANOMALY ; Lost souls (dropped)
An Omnibus of Heroes
Anon: Goddess of Anonymity
An 'Ordinary' Adventure
An ordinary novel but every 10,000 words the audience kills the least interesting character
A normal man's journey
Another Apocalypse Story
Another Chance
Another Chance (Hiatus Indefinitely)
Another Chance in Life: I am Alive Again
Another Day
Another Day, Another Quest
Another Dungeon Report
Another End
Another Failure
Another Fantasy (Canceled)
Another hero Tale: Nephilim
Another Isekai
Another Isekai Story
Another Isekai Story!
Another life another chance
Another life (Loks123)
Another Me, But Cuter
Another Naruto Fanfic (Not For Fun)
Another Novel with OP MC
Another practice
Another Regurgitated Piece of Garbage
Another Reincarnation
Another Summoned Fantasy
Another Terror Infinity Fan Fiction
Another TI Fan Fiction
Another Vampire Story
Another World
Another World and I'm still rich?
AnotherWorld (hiatus)
An Otherworldly Smile
Another World? Never Saw This Coming
Another World Online
Another World Priest
Another World: Scientist
Another World's Devil-Queen
Another World's Homunculus
Another world? Some weird magic? Sure.
Another World (Straightforward title, aye?)
Another World's Trespasser
Another world with the Bleach System
Another World with the Omni System
Another World With The Skyrim System!
Another You
A Not Quite Parallel World Story
A Not So Dark Soveriegn's Rise
A Novel World
An overly OP MC in another world.
Antagonist
Antagonist Rewind
Antagonist's Sidekick Becomes the Hero!
Ante Portas
AntiGod
Anti-Hero: Journey of Fear
Ant in Magic World.
Antithetic: Spire of Wonder
Antlin's Prophecy
Ant Lord
Antomea's Chronicle - Nina
Ant Tensei (Original) and (Redux)
A Numbers Game
An Uncertain Duality
An undead's adventure
An Undying Coward in the Apocalypse
An Unexpected Adventure
An Unfamiliar Summon
An Unhinged Author
An Un-Ideal Eternity
An Unidentifiable being even by God enters a fantasy world
An Unknown World
An Unlikely Haven
An Unthinkable Life From The Last Eternity
An untold tale
An Unusual Town
-An Unusual VRMMO Experience-
An unwelcomed and unwilling hero
An Upgraded Soul
Anxiety and the Beginning
Anya
Anyhorr
Aoi
Aoi - Part 1
A Parallel Dream
Apathetic Hero (working title)
Apathetic Transition
A Path of Business: My Loyal and Lovely Husband
A Path Of Rage
A Path to Crown
Apathy
A Pawn of Chaos in the Game of Fate
A Pawn of Chaos in the Game of Fate - Rubble Rats
A Petal Torn of Shapeless Thoughts
Apex Code
Apex Code [REWRITE]
Apex Legend in Another World [Litrpg/Dungeons]
Apex of Creation
Apex Predator
A Phoenix's life
A picture is worth a Chapter
A Pirates life isn't always gold
A Place to Belong - A LitRPG Adventure
A Place Without Wind
A Player in the Greenwood
A Play ground for an Undead Lord
A Playground For The Powerful
Apocalypse
Apocalypse?
Apocalypse 2020: Look to the Skies
Apocalypse : A New Dawn
Apocalypse Arcana - The Devil
Apocalypse at Mighty Max
Apocalypse Born
Apocalypse Boy
Apocalypse Evolution
Apocalypse Express
Apocalypse Hero
Apocalypse Hero - (Deletes July 1st)
Apocalypse in Russian style
Apocalypse?it was my snack
Apocalypse : Judgement's Day [Rewrite]
Apocalypse? No, it is heaven!
Apocalypse Now (Hiatus)
Apocalypse Now: Under Contract
Apocalypse on Endless Earths: Apocalypse How? A LITRPG Adventure
Apocalypse Override: Zombieman
Apocalypse? Paradise.
Apocalypse Please(?)
Apocalypse Rebirth
Apocalypse redone
Apocalypse Remnant
Apocalypse Remnant`
Apocalypse Respawn
Apocalypse, Sounds Like Fun
Apocalypse Start
Apocalypse Step
Apocalypse Ted!
Apocalypse The Fantasy
Apocalypse Wishes
Apocalyptica: Vector's Edge
Apocalyptic Evolution
Apocalyptic Paradise
Apocalyptic Survival- How to survive the Apocalypse -
Apocalyptic Trifecta
Apocalyptic World, Cheat
Apoch's Twilight
Apocrypha of The Dead
A Polite Society
Apollyon, The God of Chaos.
Apology of a Cold Heart
Apostate Konstantin
Apotheosis - The Dungeon of Kess
A Powerful Duke In Another world
A Power Manipulator's Multiversal Adventures
Appetizing Magic
Appless
Appolon
Apprentice of the Void
Approaching Ascension (Book 1)
A Practical Guardian
A Price In Memory (Aspect of the Beast Rewrite)
A Princess, a Dragon, a Rogue and One Other Guy
A Princess Melody
A Professional Reader's Guide to Amateur Writing
A Promise
A Protector's Circumstance
A Protracted Game [Web Serial]
A Psychic's Scarlet Dream
A Psycho's Diary
A Puppeteer's Journey
Aqua Requiem Bloodlines
Aquaria
A Queen of Ruins
A Quest for a Cure
A Quest for Existence
A Questionable Persons Questionable Look At Life
A Question of Character (shelved)
A quest to reveal the truth of humanity
Arachnid Kid?Boy?Teen?
A ragbag of stories, don't expect them to end.
Arain
A Random story of an Adventurer
Arashia: A LitRPG story
Aratana hajimari (VRMMO)
A Rather Unfortunate Gun-Wizard
A Rational Zombie (Complete)
A Rats Life
A Raymond's Raven - (The Exploration of Magic in World War 1)
Arbiter of Power (Canceled and currently redone as 'Re:' version.)
Arborea
Arcade Warfare in Another World
Arcadia
Arcadia's Ignoble Knight
Arcadias Moon.
Arcadis Park
Arcana
Arcana: The Rebel King
Arcane
Arcane Cycle
Arcane Engineer - The Awakened Dungeon
Arcane God Marcus
Arcane Power
Arcane Regeneration
Arcane's Heart
Arcane Survivalist
Arcane Transmogrification (Book Two of the Pentacle Series)
Arc a New born titan [suspended]
Arcane Wonders
Arcanist
Arcflame, the strongest tree-growing dragon
Arch
Archage
Archaic Avalon
Archaic Transmogrification (Book Two of the Pentacle Series)
Archangel
Archangel: Breaking Orbit
Archillies Duane : The World Traveller
Arch, Inc. - Secret Origins
Arching Choices
Architect of Dominion (The Darius Kane Chronicle)
[Archive] Legend of the Nameless Hero
Archive of James: Origins.
Arch-Mage? Arch-Warrior? Why Not Both?
Archmage Father
Archmage Paladin
ArchMagus
Arch Magus, The Wich Hunter
Archon
Arclight Online
Arduous New World
Area 51
A Real Life
A Reaper's Tale
A Reincarnates Story
a Reincarnation full of choices
Arena Earth
Ares
A Restart on Life
A Retired Vets New Life: An Apocalyptic Novel
Are you a Lucker? (Luck based LitRPG)
Are You For Real!?
Argent Dawn (DROPPED)
Ari
Ariair Online
Arianna's Wish
Aria of the Fallen: Adventure in a Foreign System
Aria of the Sun and Moon
ARIA Online
Aria Wanderlust
Aries
Ari-os
Aris Cretu
A.R.K
Arkandia
Ar'Kendrithyst
Arkhay (Writers block on this story..Sorry guys. might never add more)
Armageddon: A Biography of a Forgotten History
Armageddon: A New World
Armageddon Online - Escape
Armbuster
Armor Corps
Armored
Armored Prayers
Armorling wants to be a king
Armor of Justy (AoJ)
ArmourXDemons
ArmS: The Last Human [dropped]
Army of the Fallen
Arnar the Dungeon
A Robbery Of Goats
A Robin and A Crow
A Romance of Villains
A Rotten Soul
A rotten soul (short hiatus)
Arowne'S Rebirth
A Royal Warrior
Arpeligo
Arrested Alterings: A Genetic Detective's Hunt for Answers
Arrogance is justice!?
Arrogance: Lost reports
Arrogant Master In The City
Arrogant Young Master Template A Variation 4
Ars
Ars Alogia
Ars Arcana
Ars Utopia: A Fantasy Dystopia Story
Artanis Road
Artemis The Celestial Beast(Hiatus)
Artfin, Power Money and Woman [Dropped]
Arthron ~It seems I become a newbie god~
Arthropod Online
Arthur
Arthur and the Mystery of Reincarnation
Arthur ReD
Arthur "The successor of the god of time"
Artifice: Iysinfyr
Artificer
Artifice: Tools of the Gods
Artificial Biological Runic intelligence
Artificial Devastation
Artificial Light
Artificial Seed
Artificial Selection
Artificial Selection: A Near Future Thought Experiment
Artificial War
Artificial Yuusha
Artisan
Art of Alchemy
Art of Mortality
Art of Poison
Art of War
Arts Master
Art Sword Online | アートソード・オンライン
Arum: Reconquering the Dungeon World
Aruna
Arun Online [Dropped]
Arx Speculo
Arzhel's Magic Tavern
As a Dungeon
A Safe Place
A saga of Alviona, a girl who would be known as Crimson Queen
A Sage's Different World Logs
A Saviour's Endeavour
Ascendance
Ascendance: A Tower Story
Ascendance: Rebirth of the Unknown Gamer
Ascendancy
Ascendant Legacy
Ascendant of Air
Ascendant Online: A LitRPG
Ascended
Ascended Dark Sovereign
Ascenders Rift
Ascending
Ascending Hero
Ascending The Heavens
Ascending Trinity
Ascend Online
Ascend to Be GOD
Ascension
Ascension Alphas
Ascension Core: A Cyberpunk Story
Ascension From Nothing
Ascension of a Reborn Woman
Ascension Of Moba Gamer
Ascension of Shura
Ascension of Singularity
Ascension of the Godly Assassin
Ascension of the Strongest
Ascension Online
Ascension Rebirth [Dropped]
Ascension: The Helm of Lentha
Ascension To Brutality
Ascension VR
Ascent
A Scientist And His Hi-Tech Laboratory Suddenly Transported In Another World
As Crônicas dos Últimos Leanfis - Furor da Magia
A Second Chance (Invasion Book #1): LitRPG Series
A second life
A series of Short stories
A series of Transmigrated Misadventures.
A Serpentine Tale {Dropped}
A Servant of Justice
A Servant of The Empire
Asgard's First Elemental Necromancer
Ash
A Shadow
A Sh Ai El
A Shapeshifting ________!
A Shattered World
Ash Burst
Ashen Ghost
Ashen Lord
Ashes
Ashes dungeon
Ashes *Hiatus*
Ashes of Creation
Ashes of Empires
Ashes of Eternity
Ashes of Gods: Return of the Blade Emperor
Ashes of the Arctic
Ashes of the Primordial
A Short Story Collection
Ashura, Heir Of Rebirth
Ashura- The Demon Sovereign
Ashura Vale
Asiad the land of lords
A Sick Twist of Fate
A simple book
A Simpler Reality ( Revised )
A Single Thought
A Siren's Call
A Sister'S All You Need | 如果有妹妹就好了
A Sith's Journey
A Skazka
A Skill Whore's Journey
A Skin-Changer's Tale
A sky as blue as ours
A Sky of Star and Strength
A Slave's Voice (Revision Pending)
A Slayer's Diary
A Slice Of Life Of Broken Man
A Slip Of The Force
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon?
A Smidge of Magic
A Smile To Remember...
A Snail's Wisdom
A Snake's Life
A Snake's Rise
A Soldier's Fragmented Memoire
A Soldier's Life
A Soldier Tale
A Solitary God In A Dark Multiverse
A Song Calls Them Home
A Song for the New Age
A Song of Goblins and Skeletons
A Sorcerer's Footsteps
A Soul Bound Dragon
A Soul's Dream
A Soul's New Home
A Space Odd-yssey?
Aspect of the Beast
Aspect of the Forsaken
Aspect Online
Aspects of Heaven and Earth
Aspects of Nature
Aspiring Demon Lord
Assassin Alonne
Assassination Highschool
Assassination System V.2
Assassin Gamer [HIATUS]
Assassin God
Assassin or Princess? Why not both.
Assassin's Child
Assassin's Decree
Assassin's fate
Assassin's Revival
Assassin Type: The Rifle Girl- Rica Reyes
Assault The World
Assimilation
A Standard Superhero World
A Star for Every Soul
A Star is Born
A Step Behind Death
A Step into Madness (Dropped)
As the Godking Wills
As The World Catches Fire
As The World Spins
Astlan's Ira
Astoerith Online
A Storm in the Fall
A Story about a Magic Book
A Story About a Vampire
A Story in Black and White
A story in which numerous people die
A Story That You Wouldn't Want To Read +
A Story To Choice From (10 One Shots)
A story where the main character is too Op!
Astra Fabulam
Astral Arcana: Ethereal
Astral Bridge
Astral Connections
Astral Fate Part 1: Starlit Brawler
Astralfice
Astralis Lumen
Astral Land
Astral Land : The Beginning of Everything
Astral Son
A Strand of Divine Sense
A Stranger in Sorcererstown
Astrayed Absolution
A Struggle Through the Deadly
A Students Gate to Hell
A Student's Journey through Magic and Mayhem
A Study in Rain
A Succubus System? But I'm a Virgin!
A Sudden Cute Baby: My Awesome President Dad
Asunder Online [DROPPED]
Asunder Online [Indefinite HIATUS]
A Superhuman Family In Another The World?
A Superior Being Will Always Rise ... Even If They're A Goblin
A Super Robot Story
A Super Robot story.
Asura
Asura Ascending
Asura [Bleach]
Asura Swiftblade
A Sword Master's Travels (1)
A Sword's Nakama
A System To Kill Monsters?! I Just Want A Date For Prom!
A Tactician's Mind
A Tail's Misfortune
A Tale From Azad
A Tale of a Certain Lolicon
A tale of a girl and her shadow
A Tale of Casual OPness
A tale of Might and Magic
A tale of nonchalance and tomfoolery...
A Tale of Sorrow and Love: Book I
A tale of teleportation
A Tale of Twin Moons
A Tale of Two Sisters
A Tale of Two Worlds
A Tale of Villainy
A Tale of Winter
A Tale To Tell
Ataraxia Sanctuary
A Taste for the Finer Things
ATCS Ability to Change Size
At Death's Door: Legacy
Atemporal Chronicles - Commencement Tale
A Ten Year Vacation Turned Me Into A 14 Year Old Kid
Aterheim
Aterheim [DROPPED]
A terrible field trip
Athanatos
A Theft Of Stars
A Thiefs Tale
A Thief's Tale: The Road To Redemption
A Thief's Tale: The Road To Redemption v1.826
A Thousand Faces: The Villain's Journey
A Thousand Year Old
A Thousand Years Queen
A Time for Leisure
A Tingle Later: A Different Kind of Hero Tale
A Tinker's Damn - Book 1 of Descendants of a Dead Earth
A Titan's Crusade
Atk 0 Crit All ~My attack stat is negligible, so I can't help but rely on critical hits to succeed!~
Atlantean Mage
Atlantis
Atlas Code
ATL: Stories from the Retrofuture
A Toaster Story
A Tomb of Dead Stories
Atonement
Atonement of an Immortal
Atone Online
A Towel to Save your Life
A Trace of Heroism
A Tragedy for a Demon Lord
A Train Between Worlds
A Traumatized Girl's Quest for Home in a Fantasy Land
A Traveler's Tale
A Travelling Mage's Almanac
A tree's simple life
Atreo "The Delusional Demon Prince"
Atros Imperium
A Truck Driver's Tale
A True Queen's Life
Attached
At The End of the World
At The Fields of Fire and Blood
At the Top of the Food-Chain
Attuned
A Twist that Lead to the Fall
At Wit's End
A "Typical" Dungeon Capture
A typical fantasy Journey
A Typical Love Story
A Tyrant: Unshackled
Audacity Light
Audea's Seal
A ugly swan
Augmented Reality
Augmenting Reality
A Universal Tale
Auntie toasts the VRMMORPG
Aurelia Online
Aurion: The New World
Aurora
Aurora Eclipse
Aurora's Sky
Ausfagner: The First Exogenous
Authority
Authority [Dropped]
Authority: The Prequel
Author Rebirth To The Douluo Dalu World
Author sent into his own story, now what do I do?
Author Vs Protagonist
Autist Isekai
Automata Annex
Autonomous Machine Arsenal: An Evil Machine's War Record
Autumn Grim
Autumn to Winter
Autumn Winds and Crimson Waters
A Vague and Indistinct Existence
Avalon
[Avalon]
Avalon: New settlers
Avalon'S King
Avalon's Shards
A vampire life
A Vampire's Dilemma
A Vampire's Journey in a Fantasy World
Avant Garde
Avaria: A Pay To Win Adventure
Avaritia
Avast Online (DROPPED)
Avatar of Nature: The Enchantress
Avatars
Avatars of Myths and Legends
Avatar: The Wild Lands (A Medieval 'Avatar: The Last Airbender' Fiction)
Avenger
Avenger Of Destruction
Average Slime
Averno
A very strange rebirth
Ave Xia Rem Y
Avian | Krieg der Welten (German!!!)
A villainess Reborn
Avine: The Journey
A Viral Life
A Virtual Invasion
A virtual reality game according to a martial artist otaku
A Virus Life For Me
Avitus Volten's journey through space and time
A Vixen's Blood
Avoiding the Heroine and Capture Targets!
A Void Spirit's Slightly Psychotic Tale
Avonlea
A Vorrgistadt Shard - The Shattered Oracle
A VRMMORPG Adventure: The Legend of the Legendary Rogue!
Awaiting Integration (A.I.)
Awakened Cheater
Awakened; Dungeon Tales
Awakened Warmonger
Awakening
Awakening (A Necromancer's Revenge)
Awakening Chronicles
Awakening in Ruins
Awakening of a Heart
Awakening of a Monster
Awakening of an Anomaly
Awakening Of Moba Gamer
Awakening of the Unknown
Awaken Online
Awaken Online - Conception (A FanFic)
A Wanderer's Story by Dms143
A War Beyond Kings
A war for the ages
A Warlock From Elsewhere
A Warlock's Luck
A Warm Bed & A Hot Shower
A warm share of happiness
A War of Galaxies: The Things I've Seen
A War To End Them All
A Way of Life
Aw Cluck
AWE: Adventures of a Reincarnated Noble Android Girl (Rebooted)
AWE: Ballad of 3rd Crown
Awe, come on man, really, Again!
A Weird Book #1
Awful garbage
A Wheel Inside a Wheel
A Whisper Among the Stars
A Wicked Tale Of Witches, Wands, Booze, and Swagger
A Wish For Power
A Wish in the Night
A Wish Of Change
A Wish Upon The Stars
A witcher cultivator.
A Wizard of the past
A Wizard's Birth: Awakening
A Wizard's Sacrifice, Book Two of the Woern Saga
A Wizard's Soul
A Wolf among Dogs
A Wolf In Penrith - A Kammi Kettu Story
A Wolf's Journey
A Wolf's Way
A Wonderful Adventure in a Wonderful New World
A World Away
A World Beyond
A world born from ashes (undefined hiatus)
A World Forgotten
A World in Chaos
A World of Many
A World of Summoned Heroes
A World Reborn
A world travelers problem
A World Traveller
A World With My Destiny
A World With Nothing Normal
A World With or Without Aliens
A World without a System?!
A World Without a Tomorrow
A World Without Them
A world with two moons
A World Worth Protecting For
A writer's legend
Axe from North
Axiom
Ayla's Junkyard
A young girl is my master and I'm son of the demon king?
Aytelia
Azalea
Azalon
Azarinth Healer
Azeal Neralum
Azeria: The Era of Black Flowers
A-Zero
A Zombie's heart (BL)
A Zombie's heart (BL) - HIATUS
Azran - Magic King of the Darkness(Finished Volume 1/Dropped Volume 2)
Azura of The White
Azura the Slayer
Azure Tale
Azure Warrior
B1nary Bl00d
Babel
Babel - The Path To Ascension: Heaven
Babel - The Path to Ascension: The Golden Children
Baby, I Love You
Bacis: The Land of the Gods
Back Again
Back to Day One (On Hiatus)
Back to Pokemon and Earth
[Backup Online]
Backyard, cute cat eared girl changing her clothes, spirit magic to make breads and saving the world
Backyard Hero
Bacterium
Badass
Bad ass Bunny - A lack of common sense isekai for no reason.
Bad Company
Bad Habits {New!}
Bad Habits {V2 Out now!}
Bad Harem
Bad Intentions
Bad Light Era
Bad Luck
Bad Luck World
Baking Bread
Balada: When death did not exist, nor yet Eternity Part I
Balance
Balanced
Balancer-Shattered Soul
Balancing of the world
Ballad of Failure
Ballad of Mortals
Ballad of The Clay Golem
Ball of Light: Specialization
Balthazar, a case study
Bandit Host Club
Bane Blood (On Hiatus)
Bane of Ashkarith
Banned From Existence
Baphomet the Destroyer
Barakdor
Barbarian Game
Barbarians
Barbaric beginnings
Barbearian
Barrow of the Lost
Base Affection
Based on a Life
BASE Status: Online
BASE Status: Online [An Unlikely Hero's Journey]
BASE Status: Update (BASE Status 2)
Basically Yaoi, But With Ninjas.
Basra
Bastard Assassin (18+)
Bastard's Crown
Bastard's Wrath
Batman and Spider-man: Year One
Battle Avatars
Battlebond
Battle City: Rise Of The Blue Spark
BattleCube
Battlefield Reload
Battlefield Restart
Battlefield Restart 2- An Adventure Beyond Greatness!
Battlefield Restart 3- An Ascendance Beyond Destiny
Battlefield Restart- An Identity Beyond Self
Battlefield Restart (Edited)
Battlefield Restart [Reboot]
Battlefront
Battle is an Art
Battle Maiden
Battle Maidens
Battle Necromancer
Battle Necromancer Version 2
Battle Necromancer Version 2 - Hiatus
Battle of Blackfortress
Battle of Lexis
Battle of realms
Battle Of Supremacy: Heroes and legends
Battle School
Battlesquire Book I - First Blood
Battling for Survival in a New World (On Hiatus)
Battling Records of the Chosen One
Battling the World
Bayani
B-But I don't WANT to be a protagonist!
Beach Bum
Beacon in the Dark
Be a man, be a hero
Beanstalk
Bearer of the First Flame
Bearer of the Red Lotus
Bearer of Time: Haze
Bear Maid the Princess' Guardian
Beast
Beastborne
Beastborne (An Isekai LitRPG)
Beast Cultivating System
Beast Dao Cultivator
Beast fiend
Beast God
Beast Knight
Beastly - Screw being human . . . they suck anyway!
Beast mage
Beast Master System
Beastmastery - A LitRPG Novel
BeastMaster Zero By justTYM
Beast-Men
Beast Mutation
Beast of the Mountains
Beast of the Night
Beast Queen: A LitRPG/GameLit Action/Adventure (book two of Monster Slayer Online).
Beasts & Bastions
Beast Slayer
Beast Tamer Kayne
Became the Strongest Cultivator Just By Existing
"Because I am Tianzi Daiyu!"
Because I do not fit well with my life, I am given a restart!
Becket The Elf?
Become God
Become Immortal
Become Strong!
Becoming
Becoming a God
Becoming a mesiah
Becoming God
Becoming Itachi Uchiha in a Different world!
Becoming Legend Companion PokeDex
Becoming my rival's love interest!
Becoming Renegades in Another World!
Becoming the Protagonist of My Own Delusional World!
Becoming The Wolfman
Bedlam - A litRPG Novel
Bed of Glory "Conqueror of all Worlds"
Bedrock 岩盤 Ganban
BEEADDLEDRUNG ⁠— Serial Bogeyman
Before:After
Before a Legend
Before the Day Is Done
Before the Fall
Before They Came
Before They Came (Magical Apocalypse)
Beginners Guide to Dungeoneering
Beginners' Guide to Dungeoneering
Beginning Of Reality
Begin the End
Begsissbbdd
Behemoth
Behemoth hunters
Behind Your Smile | 你的笑容
Behold the Bacterium
Being
Being an adventurer is harder than it looks!
Being chased by the heroes because I am a Master Puppeteer.
Being Frank
Being God is Fun
Being Human (Completed)
Being in the Grey : Awakening
Being the God of Hell is a bother
Being the God of Hell is a bother [On temporary hiatus]
Being Undead
Bellwether
Bellwether 1
Bellwether 2
Beloved Protection from a nine tailed fox
Below The Distant Sky
Bend
Beneath the Iron
Benjamin
Benjamin's Account of Adventures
Benji and The World Spike
Ben the Dungeon
Best Friends Forever?
Beta Life, Digital Sorcery Book 1 (A LITRPG Adventure)
Beta Test
Beta Testing for Implementation of Status and Power
Beta World
Beta Zero
Betrayed by Light
Betrayed by Light - Complete Book 1
Betrayed in a Blessed World (Web Novel)
Betrayer of Humanity
Better Days
Better Than Life
Better than one
Better To Be Lucky Than Good.
Between the planes
Between War and Magic
Beware of the Synthetic Siblings
Beware of Zombies
Beyond
Beyond?
Beyond Blood and Bone
Beyond Blue
Beyond Death:Monster
Beyond Floating
Beyond Foundation
Beyond Gods
Beyond Humanity
Beyond Humanity: Lightning Falling and Hook of Rage
Beyond life
Beyond Limitations
Beyond Mortality
Beyond/Odyssey
Beyond The Abyss (Rewrite)
Beyond the Balance
Beyond the Black Sea
Beyond the Bridge
Beyond the Dungeon
Beyond The Evergreen
Beyond The Game
Beyond The Game (Abandoned)
Beyond The Grey Skies
Beyond the Horizon
Beyond the Horizon's Eye
Beyond the Mists (Shuli Go Vol. 1)
Beyond the Ordinance
Beyond The Other World
Beyond The Primordials
Beyond The Primordial Void
Beyond The Primordial Void (Dropped)
Beyond The Sky
Beyond the Stars
Beyond the Star Ways
Beyond The Wall (Complete)
Beyond Time and Space
Beyond Truth
Beyond Worlds
BF Training Course
Big Damn Heroes
Billionaire's Fake Wife
Binary Blood
Binary of Life and Death
Binary Progression
Binary Progression: The wild west of MMOs
Binary Soul
Binded
Biomancer: Songs of Sirens
Bio Synthesis
Birth Cult
Birthday Online
Birth From Darkness
Birth of A Death God
Birth of a Devil
Birth of a God
Birth of a Monster
Birth of God
Birth of Mana
Birth of Sin
Birth of the Conqueror
Birth of the Dragon King
Birth of the Dragons
Birthright
Birthrights
Bite
Bitten
Bitter
Bittersouls
BKR: Bandit King Reborn
Black And White
Black Apocalypse
Black Beast
Black Belly Enchantress
Black Blood
Black Blood (now on break... it'll be back... Eventually...)
Black Book Saga
Black Cloak, White Art
Black Coin
BlackCrown
Black Death
Black Dragon Rising
Black Dragons Rain
Black Feather
Black flame Devil
Black God of Lightning.
Black Heart
Black Heaven Ascension
Black Hole Traveler: Beyond Jupiter's Door
Black Home
Black Ice
Black Iron & Cinder
Black Kingdom By CallMeDeliverUs
Black Knight
Blacklight
Black Magic
Black Magic Hero
Black Meridian
Black Mist: Daniek of the Black Blood
Black Moon
Black Rain
Black Roses Rewrite - YYH Fanfiction
Black Sheep
Black Sheep - A Permadeath Book
Black Sheep [dropped]
Black Sky
Blacksmith
--Blacksmith's Ire, Book 1 of the Vengeance of the Wind Trilogy--
Black Space
Black Steel Brandy
Black Storm
Black Sun
Black Tears (to be revised)
Blackthorne
Black Tiger God (黑虎神)
Black Titan
Black Watch Asylum (Hiatus)
Black Wind
Black World
Blade
Bladed Advent
Blade Judgement
Blademage Beastmaster
Blade of Chaos
Blade of Crom
Blade of Death
Blade of Gaia
Blade of shattered reality
Blade Origin
Blade Quest Vol.1
Blades and Bonds
Blake Byron: Paranormal Investigator
Blame (Hi-Chan)
Blank: a Story of Good Intentions
Blanks: Magi Of The Red Desert
Blankspace
B.L.A.N.K- The search for the meta
Blarg the Meh Ai
Blastocyst
Blaze
Blaze contractor
Blazing Translocation
Bleeding Hearts
Blessed
Blessed Time
Blessed with a curse (BwC) [Tryout.]
Blessing
Blight and Bloom
Blightbane
BlIghted
Blind
Blind man's path
Blind Punch
Blind Spear Goddess
Blink
Blink, A Dungeon Core Story Unlike Any Other (Because it's terrible beyond belief)
Blinker
Blockage of Writing
Blood Amongst the Sand
Blood & Carrots
Blood & Fire: Insurrection
Blood and Bones
Blood and Gold
Blood and Honor
Blood and Honor: Ascension
Blood and Honor: Dark Scion
Blood and Honor: Deathwalker
Blood and Honor: Emperor's Fangs
Blood and Honor: Engineer's Aptitude
Blood and Honor: Fallout
Blood and Honor: Honor among Thieves
Blood and Honor: Redemption
Blood and Honor: Rise of Atlantis
Blood and Iron
Blood and Magic
Blood and Passion
Blood and Sacrifice
Blood and Silence
Blood and Silver
Blood Born
Bloodborne
Blood Brothers Rising
Blood Calamity
Blood Control
Blood Creed
Blood Destiny
Blood Drinker
Blood Drive
Blood Emperor
Blood Emperor [Dropped!!]
Blood Fractal
Bloodgames - A Battle Royale LitRPG
Blood is dark
Bloodlain
Bloodless
Bloodline
Bloodline plunder
Bloodlines
Bloodline: World Domination
Bloodlust
Blood Mage Bastard (A LitRPG)
Blood Merchant Empire
Bloodmoon Destiny
Blood Moon Hunters
Blood of an Inhuman Hitman
Blood of an Inhuman Hitman (Rewrite)
Blood of Lilies
Blood of the Guardian
Blood of the Past
Blood of the Serpent
Blood Princess (completed)
Blood Redemption
Bloodreign
Blood Rejects
Blood Rising
Blood Rose
Blood Sapphire
Blood Seekers -- The Monolith
Blood Shark
Bloodshed
BloodSmeared
Blood Soaked Star
Bloodsong
Blood system
Blood To-Go
Blood Virtuoso
Blood Virtuoso: a goblin's story
Blood Virtuoso: a monster evolution story
Blood Virtuoso: an evolution story
Blood World - Sacrifice
Bloody Angel
Bloody Conqueror
Bloody Dragon
Bloody Grass
Bloody Hell
Bloody Killing Game
Bloody little Monster
Bloody New World
Bloody Specialist
Bloody Wave Unlimited
Bloody Wonderland
Bloom
Blooming Thorn in Another World
(BL) System, WTF!
Blud
Blue Blood
Blue Blood Servant
Blue Boundary
Blue Core
Blue Cruelty
Blue Hills
Bluelight Chronicles - Going Solo
Blue Mist
Blue Moon Emperor
Blue Moon Saga
Blue Phoenix
Blue Pill
Blue Screen Blues
Blue Seed
Blue Seed - Path of a Mage King
Blue Soul
Blue Star Cultivator
Blur
Blut und Eisen: Blood and Iron
Bob and Sam up to no Good
Bob in the land of the gods
Body&Shadow
Body and Soul
Body Molder
Bogatyr
Bonded
Bonds of a Brother: The Iron Cross
Bonds of Gold (HP Fanfiction)
Bone Dungeon: Book 1 in the Elemental Dungeon Series
Bone Lord
Bone...r?
Bones
Bones in the Sun
Bonfire of Souls
Bon Week-end
Boogeyman
[Book 1.0] -- Perth'S Accidental Superheroes
Book 1: A certain magic kingdom
Book 1: Demonic Wolfsbane
Book 1 of the Falconer series: Hearts of Ice
Book 1 of the Immortal Sun Mist Emperor Saga- Novus Magus
Book 1 of the Immortal Sun Mist Emperor Series- Novus Magus
BOOK 1: THE CURSE OF ASMODEUS -- (a Perth's Accidental Superheroes series)
Book 1: There is No God
BOOK 2: THE WRATH OF ASMODEUS -- [a Perth's Accidental Superheroes series]
BOOK 3: THE REVENGE OF ASMODEUS -- [a Perth's Accidental Superheroes series]
Book 4: Escape From Planet Of Asmodeus [ A Perth'S Accidental Superheroes Series ]
Book 4: The Brothers Dyne
BOOK 5: THE RETURN OF ASMODEUS -- (a Perth's Accidental Superheroes series)
Bookkeeper
Book Of Chaos
Book of Creations
Book of EscaLod
Book of Fates: The Forgotten Shores of Ferax
Book of Heroes - Rise of the Shadow Walker
Book of Kindness
Book of Liz
Book of Monsters
Book of Mortus
Book of Reality
Book of Sand
Book Of Soul
Book one: Change
Book One: Queen of The Forest
Bookworld Online: Marsh Man
Bookworld Online: The Rogue Necromancer
Bookwyrm
Boop!
Borderlines
Bored Evil
Bored Gamer in Other Worlds
Bored Hero
Boredom Made Me Do It.
Born a Demi-God (Hiatus)
Born a male xenomorph
Born among the Stars
Born as Slime In New World
Borneo
Born From Evil
Born in Abyss: The Dark Devil
Born In One (one piece fanfiction)
Born of Dusk
Born to Heal, Grown to Steal
Born under the moon
Born with a Dragon Tattoo(Dropped)
Borrowed Time
Boss
Bottled up wishes
Bound by Blood
Bound by Duty
Bound by life and death
Bound by Moonlight
Boundless (Completed)
Bounty Cats
Bow of the North
Brain Cultivators
Brainiac Dungeon
Branch Adventurers Guild
Branch Adventurers Guild [Dropped]
Branded
Brand New Night
Brand New World
Brand of the Dragon
Brave Realm Odyssey - Adventurer Resolution
Brave Soul
Bravest Soul
Brave World Online
Breach World Championship 2081
BreakDown
Breaker of Chains
Breaking Chains
Breaking Horizons: Book 1: Snared Origins
Breaking Limits: A DBZ Fan-fic
Breaking Syd
Breaking the Mold
Breaking up, No Joke
Breakout: The Evolution of a High School Nerd
Breakthrough
Breathe in the Embers
Brian Saves the World, Maybe
Brian'S Note Book
Brian the Drow: A LitRPG Adventure
Briars and Thorns
Bricks of The Temple
Bride of Prince
Bridge of Storms
Bridging The Gap; The Final Records In Unova: An Autobiography
Bright Battle Story: Tactics Heart
Bright Decay
Brightest Doom
Bright Feather
Bright Night Online
Bright "yuri"
Brimstone
Brimstone Fantasy
Bringing Anime Skills to Another World Using Imagination
Bringing Chaos to the Immortal World with God's Powers
Brink
Briox the Magus
Broderick's Home for Curious Kids
Broken
Broken Angel
Broken Chains
Broken chains of mortality
Broken Cheat
Broken Kaleidoscopes
Broken Lance
Broken Pieces
Broken Reality
Broken Realms: Battle of the Gods
Broken Shards
Broken Skulls, a Skeleton's Tale
Broken Sky and Shattered Earth: Apocalypse Convergence
Broken Soul (MoTheGreatOne)
Broken System
Broly In Naruto
Broly In Naruto (COMPLETED)
Bronze Mirror
Bronze Wings: A Steampunk Pirate Harem Adventure
Brotherhood of Assassins
Brothers in Arms
Brujas de la Noche
Brutality
Bruxas da Noite
Bubin
B.U.D
Buffy's New World Order
Bug in This Game
Build-A-Harem (ongoing)
Builder of Power
Building a nation and make its citizen happy
Building Home
Building Home Book 2 - Rescue
Building my faction in another world
Building the Star Forge Empire
Bullet Blonde
Bullets & Spells
Bumi
Bunkercore
Burn Artist
Burned Phoenix Rises
Burn in fel fire
Burning Heavens
Burning Soul
Burning Stars, Falling Skies
Burning Winter
Burra: Short Stories In the Shaper Universe
Business Manager in a Barn
But, Have You Read This Yet?
But I never wanted to be involved
Butterfly's Dream
Butterfly Weed
By Any Magical Means Necessary
Byōki no hitobito wa betsu no sekai ni tsurete ko raremashita.
By The Sword
Cadorna Keep
Caged Demons: Entrapment
Cain's Daughter: Baptism of Fire
Calamity
Calamity Blade
Calamity Mandate
Calamity Star
Calandoris
Calforn Chronicles (Original)
Caligo Tenebris
Calla
Called Upon
Call it a Mission
Call Me Emperor
Call of Carrethen
Call The Manager
Calm Calamity
Cambion
Camelot Defiant
Camelot Dungeon
Camelot Overthrown
Camelot Resurgent
Camiare: An Isekai
Canaan: My World To Live
Can a holy hero be born from such a person?
Can a Lich Cry
Canary
(Cancelled) A Purgatory Beast's Summoning
(Cancelled) The Shadows Embrace Me
Candor: The Forgotten House
Candor: The Lost House
Can I Borrow @You?
Caninstinct
Can i please get a female demon lord on the 10th world(Hiatus)
Can I really create a VR game?
Can I really keep my Goddess Wife to myself and away from all the Crazy OP MCs?
Cannibal Dungeon
Can somebody save me? Really? No one?
Cantaga Station
Can't a Girl be a Fearsome Demon Lord?
Can't Cure Deceit
Canticle: Code Caligula
Cantina KnowWhere
Cantrip - A Wizard's Tale
Can you Hear the Stars Calling?
Can you please stop killing me? a lit RPG adventure
Capo: Rise of a Gang Lord
Captive God
Captive Hero
Carabell's Lowlife
Card Game
Card Hero 2020
Card Master System
Cards of the Royal Guard
Carefree Cultivation
Careless Wish
Carl@Fire
Carnage
Carnivores: Aurora
Carn Online: Second Chances
Carrion Crow
Cartilage Of Life
Cartoon Vs Rpg World[Working Title]
Carving a Path
Casa do Diaño: The Fool
Case Notes: L0St
Cassandra
Cassidia
Cassidy's Change
Cast
Cast 2
Castaway of Aturge
Casted Away {will probably change the title}
Cast In Steel - Transferance
Castlebound
Castle Kingside
Cast Out
Cast Under Ellitis
Casus Belli
Cataclysm
Catalyst
Catalyst: The Trading Card Game
Cata Maestra
Catastrophe Teacher
Catastrophic world
Catch All The Girlfriends!
Catch Me If You Can (a PicYourStory entry)
Catch the Wind
Catgirl in the Pantry
Catgirls of GRIM
Cat Girl Was Not My First Choice
Catmaster Online: A LitRPG Series
Cat Who Walks Thru the Wall
Causality Hopscotch
Cave Crawl
Cave of the Fallen
Caveship
Caves of B´lo
Cayleth
Cecil Bee's Flash Fiction
Celeste Academy
Celestial Beings
Celestial Black Star
Celestial Child
Celestial Fox
Celestial Games
Celestial Games (Book 1) Original
Celestial Magus
Celestial of the Void
Celestial Realms
Celestial Reaper
Celestial Void
Cennet's Cyborg
[Censored]
Centifire: Deciphering Magic
Centipede
Centipede: A LitRPG
Central Intelligence Ashitra (Isekai)
CEO Cinderella - A modern humorous retelling
CerberuS Awakening
Cerberus Wakes
Ceron Devourer Of Souls: Book One
Ceusawah
Chain Chronicles of Glory Zero Day
Chained
Chains
Chains of Dominion
Chains of life
Chains of logic
Chains of Servitude
Chains Saga -
Chain Warden
Chain Worlds: In the Name of the Allfather
Chain Worlds: Rise of Three
Chain Worlds: The Third Fleet (Completed)
Challenged Dungeon and the Arrival of Mana
Challenge: Get Atsuko a Great Life!
Challenger of God's Land
Challenging Destiny
Chameleon: My True Face
Champion is Playing
Champion of Chaos
Champion of Death
Champion Of Goddess Of Light
Champion of the Smith
Champions
Champions and Hunters: Two Worlds Collide
Champions of the Boundary
Champion's Path
Chamrosh
Chance for Change
Chance Meetings
Chance to a Fantasical World
Changed Soul
Change Is Inevitable
Change My Heart, Change My World, Change Me
Change My Mind (Updates Fridays)
Change: New World
Change's
Change The World
Changing Fate
Changing Oneself
Changing the course of life
Changing World
Chao Mundi
Chaos
Chaos: Balance within
Chaos Children: Devourer
Chaos Cloud
Chaos Destiny
Chaos Dragon
Chaos Fiend in the Naruto World
Chaos Fountain | A Chronicles of Ascension Novel
Chaos Godking (Old)
Chaos Godking (ReWrite)
Chaos (old)
CHAOS ONLINE : Paradise of Criminals
Chaos Rising
Chaos Sequence
Chaos Theory
Chaos Traveler
Chaos Traveller
Chaos Wave
Chaos World
Chaos World Chronicles : Dissolution of Cascany
Chaos Zone online(CZO)
Chaotic Berserker
Chaotic corner
Chaotic Duality
Chaotic Emperor
Chaotic|Nonsense
Chaotic Shadows (Temporary Name)
Chaotic Souls (Dropped...)
Chaotic Symphony
Chapter and Verse
Chapters of Pain [Anthology]
Character Overload
Character Wonders
Charlie Foxtrot Zero
Charlie Foxtrot Zero: Existance Saga Book 1
Charlotte Powers: Diary of a Would-Be Superhero
Charon's Touch
Charred The Final Hope
Chase the Thrill
Chase Your Dreams
Chasing Experience
Chasing Freedom
Chasing Legacy
Cheater God
Cheaters Always Win
Cheaters Always Win (REVAMPED)
Cheat Hero
Cheating Monster
Cheating Side Kick
Cheshan
Chessboard War (The God's Game Book One)
Chessboard War: The God's Game Book One[First Draft]
Chidetan Odyssey
Child God
Child of Bone and Darkness
Child of Fate
Child of God's Fantasy
Child of God's Fantasy (HITAUS UNTIL FURTHER NOTICE)
Child of Mystery
Child of Night
Child of Nightmares
Child of Terra
Child of White
Children of Day Zero
Children of Diaspora : Seeking Shelter
Children of Kathaldi
Children of Ohst
Children of the Galaxy
Children of the Halo
Children of the Lodestar
Children of the Plague
Children of the Singularity (S4)
Children of The Sky: Heartcore
Children of the Sun (Ancient
Chilledren
Chillin' in a dungeon
Chimera
Chimera Dire
Chimera King: The Rebels of Last World
Chimera, The Unwilling Familiar
Chivalrous Thief
Chocolate Obsessed Genius Mage
Choice of Fate: Online
Choice of the Last
Choices
Choose Your Class
Choosing Magic
Chopin's Penny :: (The Reincarnated Diaries of A Classical Composer and a Freeloading Lazy Witch)
Chopin's Penny :: (The Reincarnated Diaries of 'The Ant and Grasshopper' through a Classic Composer and a Lazy Witch)
Chora (The Crystal Saga series book 1)
Chosen
Chosen - A CYOARPG
Chosen Chaos
Chosen Fate (Reincarnation Giver)
Chosen of Death
Chosen of the Mirth
Chosen of the Veiled God: Death March
Chosen Shackles
Chosen Sun
Chromatic Caverns
Chromium
Chronicle of the Fated General
Chronicler's Tale
Chronicles of a dark lord
Chronicles of a Dungeon Core
Chronicles of a Dungeon Core (Side Stories)
CHRONICLES of a PC Gamer Stuck Inside an RPG Book One: Duelist
CHRONICLES of a PC Gamer Stuck Inside an RPG (Book Two: Successor)
Chronicles of Arrath
Chronicles of Athionia
Chronicles of a Wing Commander
Chronicles of Creation - Tale of the Elder Witch
Chronicles of Firs
Chronicles of Genticus: Invasion of the North
Chronicles of Grand Deus
Chronicles of Gray
Chronicles of Heroes: The White-Fire Covenant
Chronicles of Hui Yuan
Chronicles of Ionathan Spellweaver
Chronicles of Ionathan Spellweaver [pending rewrite]
Chronicles of krendreon
Chronicles of Leofric [Dropped]
Chronicles of Magnus
Chronicles of Mana
Chronicles of My New Life as a World Owning God
Chronicles of Phartassia: My Teacher, Fox
[Chronicles of Sevestia] Book 1: Rebellion
Chronicles of Soma: Rise of a King
Chronicles of Sora: All over again
Chronicles of Sora: Ruler of Rules
Chronicles of The A.I
Chronicles of the apocalypse
Chronicles of the Blade By GnomeBob
Chronicles of The Dragon Empire: Rise of the Dragon King (Rewritten)
Chronicles of the End
Chronicles of the Last Hermit
Chronicles of The Magical Sword Sovereign
Chronicles of the Paranormal
Chronicles of the Radiant God
Chronicles of The Random , Unfinished Stuff I Wrote.
Chronicles of The Shell Mage
Chronicles of the Shura Clan
Chronicles of the Sovereign Otherworlder
Chronicles of the Spider
Chronicles of the StarFighters
Chronicles Of The Storylord: 12th Chronicle - Origin
Chronicles of the Survivor
Chronicles of the Sword Dragon
Chronicles of the Tiger Immortal
Chronicles of the Titanomachy
Chronicles Of The Voidbearer
Chronicles of the Wanderer, Siúlóir
Chronicles of the Weakest Wind Mage
Chronicles of Thyderalis - A Hero Returns
Chronicles of Trial and Error
Chronicles of Trial and Error (re-write)
Chronicles of Xod
Chronicles of Xod (returning from hiatus)
Chronicles of Zach
Chronicles Of Zaria - Book 1: Dawn Of Akaal
Chrono Born
Chronokinesis
Chrysalis
Chrysanthemum
Chuunibyou in Cultivation World
Ciarra the Cold
Cielo Pantasia
Cinap: Academy
Cinder Roots - A Treant's Tale
Cinder Souls II
Cinnamon Bun
Cionis Key
Ciphered Realm: A LitRPG Adventure
Cipher's Quest
Circle of Shards
Circle System
Circumventing Fate
Citadel World: The URANUS code
Citizen Rat and Other Stories
City dungeon
City Dungeon Abyss
City Management
City of Champions Online
City of Devils
City of Ohst
City Of The Banished
City States (Working title)
Civilization: Rise of Empires
Claimed
Claimed by the Gods
C l a i r e
Clan of Exiles
Clan of The Alchemist
Claret
Clash of Gods
Class-A Threat (Disgardium, Book 1) by Dan Sugralinov
Class Crystal Battles
Class Evolution
Class: God-slayer
Classless
Classmancers - A MOBA Esport Story
Class: Master of Time
Class Neutral: Stranger is Coming
Classroom of Doom
Class: Space Marine
Class Z Calamity
Class-Z Calamity
Clay the Golem
Cleaning Up The Future
Clean Slate
Clear
Clear Binding
Clear River Flowing Silently
Clerical Error: A Challenge of Vircon Adventure
Cleric or Necromancy?
Cliche?
Cliché cliché the classic cancer cliché
Cliché Fantasy I
Cliche Necromancer Story
Climber: Towers of the guardians
Climbing out of the Ruin
Clock Link: A Story of Magic and Murder
Clockwork
Clockwork Memoria
Clockwork powers? Sure! Wait, why am i on a fantasy world?
Closed Beta [A Star Nova Prequel]
Cloud 9 Rebirth: Adventure In New Dwarden (Working Title)
Cloud Academy Aerendel
Cloud Dungeon
Cloudlark
Cloud Rider
Cloud Shrouding the Sky
Clouds of Fauna
Clover: A Seeker's Story
Clue
Coalescence of Two Lifetimes
Coda's adventure
Code Antony
Code Death[Dropped]
Code Jumper - A GameLit Novel
Code name [Blood Cry]
Codename: Eldritch - Screw Sanity . . . I've lost it anyway.
Codename: Freedom - When VR Gaming Hurts
Code Name: Genesis
Codename Prometheus
Codename: Raven
Code: Ragnarok
Code Red
Codex
Codex Haereticorum
Codex of creatures: Salvation
Codex of Shadows
Codger
Coeus?
Coffee & Slime
Coiling Dragon: Untold Stories
Coin
C.O.L.A. Beration
Cold
Cold Expanse
Cold Havoc: Carl, the Destroyer
Cold Reign
Cold Space, a LITRPG space story.
Cold Steel Dig
Cold Sword Mistress
Collateral
Collection of Short Stories
Collector's Guild
College Student To Chosen Hero
Collision of Myths
Colonize
Colors
Colosseum 72
Colossus' Dream
Colossus' Legacy
Coma (LitRPG Story)
Combat Origin: A Dystopia Gamelit Adventure
Come And See
Come Sevenfall
Come to Management
Coming Down
Commander Daggen
Command Line: Failure
Commoner Online
Companion Farmer
Company of Heroes: Power Fantasy
Competitive Edge: The Rebirth of an Idiot
Compilation of short stories
Completely Lost (Dropped)
Completing the List
Conba Shiroppu
Conception
Concept of the Novel
Conclave of Tyrants
Concordant Fall
Concrete Chaos
Condition Evolution
Confessions of a 22 year old Introvert
Confessions of the Magpie Wizard
Conflagration - A Fantasy Haven Series part 1
Conflicted Feelings
Congratulations, You're Dead!
Congratulation, You got the Job!
Conjured Villain
Conquer
Conquer Everything
Conquering The Heaven
Conquering the World as a Goddess
Conqueror
Conqueror Online: Soul Summoner
Conquerors
"Conquerors Domain" By xipzo
Conquerors (Dropped)
[Conquerors Of The Delve] [Abandoned]
Conquer the World
Conquer Your Own Fate
Conquest: A LitRPG Story
Conquest Apocalypse
Conquest of Arcadia
Conquest of the Evolutionizing Extraterrestrial Being
CONQUEST: The Dungeon Core Gambit Book One (SAMPLE)
Conscientia
Consciousness Error
Conscripted
CONSOLE ~Another World Transfer Chronicle Starting From the Conversation with God~
Consor
Consort
Conspiracyland
Constantine
Constellations
Construct Your Fate
Consume
Consume: The Scourge Wars Book 4
Consuming Earths, Devouring Skies
Contact First
Containment Pacific
Continental Chaos
Continue Online - Sample
Continuum
Contract; A Bless with a Curse
Contract from the Abyss
Contractor of Flames
Contract: Restart
Contract Summoner
Contradiction
Control + Alt + Sadit
Controllers
Control the Universe
Convergence of Fates
Convergence of Night
Cooking with Oinos
Copper Claws
Copperscale
Copyright [HIATUS]
Corbeau
Core
Core .001
Core and Guide
Core of Metal, Heart of Blight
Cores
CORE: The Volcanic Dungeon
Core Wars
Core Worlds
Corinth
Cor Navim
Corners of my soul
Corner West and Lenchen
Cornucopia of Hope
Coronation Day
Corpse
Correcting My Martial Path
Corrosion
Corrupted
Corrupted Guardian
Corrupted soul
Corrupter of Worlds
Corruption
Corruption of the Aether
Corruption of the Demon Lord
Coruscant Ela
Cosmic Progenitor
Cosmos
Cosmos-Slaying Calamity Blade
Cosmos Traveller
Counterattack: Reborn into Warmth
Counter Magic
Counterpart
Counterwizard
Countless dreams
Countless Minds
Coupe - The Art of Rebellion
Couplet
Couple That Can't Touch
Cowboy, Reborn.
Cracked Coffins {Book One}
Cradle
Crafter's Passion (AKA Gleaners' Guild)
Craftsman
Craftsman of Blood: Demonic Beginnings
Craftsman System In My Hero Academia
Craftsman System In My Hero Academia (COMPLETED!)
Craft Spirits
Crafty devil
Crain Chronicle
Crash Alive
Crashed Into Fantasy
Crashlanded on an Unforgiving Hellscape
Craven: Reincarnated Mercenary[First Draft]
Craving for Potions (RAGEQUIT)
Crazy Blacksmith
Crazy Diamonds
Creases and Folds by Origami
Creating A Continent of Magic
Creating a World RPG
Creating a world [Russian]
Creation system
Creation - The Path of a God
Creative Dumpster Fire
Creative thinking is everything I have
Creative Writing Prompts Writing Practice
Creativity Can Fix Things
Creator
Creator Advance
Creator Goddess Lisa Strife - Book 00: Welcome to Your New Normal
Creator of Worlds
Creed
Creep
Crest Fallen
Crestruction
Cries from the Dust (Working title)
Crimson
Crimson Crown
Crimson Crow: Thief of Fortune
Crimson eyes in a world of cultivation.
Crimson Gloom
Crimson Ice
Crimson: Life in the Virtual World
Crimson Love(BL)
Crimson Marble
Crimson Moon
Crimson Night Sect Young Ancestor
Crimson Pervert
Crimson Qi
Crimson Sky
Crimson Snow
Crimson Violet
Crisis
Crisis of Civilisation
Crisis Zero
Critically Impaired
Crocodile Reincarnation Story
Croenas story of creation
Cross Gun
Crossing Paths with a Snake
Crossing The Divide
Crossroads
Cross Roads: God's Reminder (Book Two)
Crossroads - Tournament of All
Cross world crisis
Crow
Crownless: Veni Vidi Vici.
Crown of Darkness
Crown of Despair
Crown of Heroes
Crown of the martyr and martyr of the Crown.
Crown of Thorns
Crows Feast
Crucible - A Lost Dungeons Tale
Crucis
Cruel Affinity
Cruel reality
Crushed and Cursed
Crushing Hearts
Cry of the Mer
Cry of the Mer Extras
Cryptic Asunder
Cryptic Asunder (Book one)
Crysolis
Crystal Core
Crystal Creature
Crystal Down
Crystal Evolution! The Tales of a Ruler Crystal!
Crystal Guardian
Crystal Heart
Crystal High
Crystal Magic
Crystal Shards Online - A LitRPG Series
Crystal Skies
Crystal Trouble.
Cuddle & Monster
Cultivating Civilization
Cultivating Dungeon
Cultivating Earth
Cultivating Earth [Hiatus]
Cultivating Elf
Cultivating Godslayer: Another GameLit Harem Novel About a Cultivator Who Reincarnates in a World of Magic
Cultivating Magical Kingdoms ?✨?
Cultivating Monster
Cultivating Queen of the 13th Realm (slow releases due to me being lazy)
Cultivating the Cosmos
Cultivating the Universe (Temporary Hiatus [Until June])
Cultivation Anomaly Type 1B
Cultivation Apocalypse
Cultivation at Home!?00
Cultivation at home!? ( CAH!? )
Cultivation Bug Fuyo
Cultivation Is Now A Reality
Cultivation of a Phoenix
Cultivation Online
Cultivation Path of the Black Dragon
Cultivation Queen
Cultivation Sect in Great Age of Piracy
Cultivation System
Cultivation Systems
Cultivation with a status screen
Cultivator in a Magic World
Cultivator in Narutoverse
Cultivator In The Magus World
Cultivators are extinct!
Cultivator's Fantasy
Cultivators: Journeys (Hiatus)
Curiosity Didn't Killed the Dungeon
Curiosity killed the cat
Curiosity Killed The Imp
Curo [Hiatus]
Curse: Birth of The Cursed Magician
Cursed Alter (First Draft)
Cursed Anti-Hero Against the Gods
Cursed Armor Reincarnation
Cursed Blood
Cursed by a goddess...
Cursed child
Cursed Children
Cursed Era
Cursed Heroine
Cursed Reincarnation
Cursed World (LitRPG Fantasy Adventure)
Curse from God, Live a Thousand Lives: Second Life
Curse Gunner
Curse of Change (Hiatus)
Curse of Clwyd
Curse of The Dark Side
Curse of the Forsaken
Curse of the Kat
Curse of the Kat (Dropped)
Curse of the Reaper
Curse's Curse (On-Hold)
Curses, magic, and curiosities.
Curves of the Game
Cute Psychic
Cutest in the Omniverse
Cutthroat
Cy
Cyber Clash Online - Synchronization
Cyberhawk
Cybernetic Array God
Cybernetic Monster Lord
Cyber V - RoyalRoad Edition
Cyberworld ALICE: Terror Rising
Cyber World Alpha
[Cyborg] - In A World Of Magic
Cycle of the Tides
Cycles of Power
CYOA -- Pandora's Gacha World
Cyrus: Return of The Persian Monarch!
Czar Of Combat: Kings
Daedalus
Daemon: A tale of darkness
Daemon Born
Daemon Dungeon Core
Daemonia Graveyard
Daeva
Dagon, Dungeon evolved
Dah Ork Life!
Dai Kin - Naruto Fanfiction
'Daikon' Ball
Daily Life of a Bored Archdevil
Daily life of An Avenger (An Arifureta Fanfic)
Daily Life of Divine Lord
Daily Life of Divine Overlord
Daily life of reincarnated goblin
Daily life of reincarnated goblin [Dropped]
Dainatian Chroniclesm *Hiatus*
Dairy of Valerian Laliashili
Dakila
Damian Dawn in another World
Damn! I just want to ask her out!
Damn it, Maria!
Damn it, Maria! (Published on Amazon and Paperback edition)
Damn,Now That'S An Adventure
Damon's Rache
D&D Adventure Story : Hoard of the Dragon Queen
Dance of the Phaegon
Dancer may
Dancing, Falling
Dancing Skulls
Danger Zone
Daniel Solhoeg (A TWI fanfic)
Danimal
Danimal - Español
Danny Styles and the Thunderdome
Dan's Shoppe of Oddities
Dante's Immortality
Dantian: The Unforgettable
Dao Fang
Dao Fang( hiatus)
Dao is All-Encompassing
Dao: Journey to the Top of the Universe
Dao of Emperor
Dao of Repetition
Dao of Zenith Chronicles - Visionary Fantasy with Metaphysical Twists.
Darcy Sparrow and the Spectral Hound
Dare ga Oujo-Sama?... Boku?
Dargon
Dark Academy. LitRPG series: Transformation (Book 4)
Dark Ashes
Dark Avenger: Flames of Hatred
Dark Beginnings
Dark blood
DarkBoi69's mediocre, rushed and badly-written aventure
Darkborn
Dark Bushido
Dark Chronicles
Dark devourer
Dark Dragon King
Dark Dungeon
DARK EDEN: The Death God's Origin
Darkened
Darkening winds
Darkest Entity
Darkest Shadow
Dark Fantasy Short Stories
Dark Flame
DarkForce: Conquest Expansion 1 (LitRPG Mini-Series)
Dark historiën
Dark Jokes
Darklands: Book Three of The Rhenwars Saga
Dark Lands: The Exile and the Prince
DarkLight
Dark Light
Dark Lily
Dark Lord Dumbledore
Dark Lord For Dummies?
Dark Lord of Tartarus
Dark Lord Saga (Original)
Dark Mage: The Offer
Dark Memories: Rebirth
Dark Memories: Revival
Dark Mind
Dark Moon : Fallen Heart
Dark Moon : Rise of The Dark King
Darkness
Darkness God Shura
Darkness in the Heavens (Hiatus/Dropped)
Darkness Rising
Darkness, Silence And Really Bad Breath
Darkness within darkness
Dark Night
Darkpawn
Dark Rain : Book 1 of The Aetherium Saga
Dark Realms Book 1 : Creation
Dark Remnant - Injustice
Dark Retainer
Dark Seas Leading Demise
Dark secrets
Dark Skies
Dark Sky and a New Start
Dark Souls
Dark souls:Greg's Story!
Dark Spine - Envoy of Darkness
Darks Rising
Dark Star Survivor
Darkstorm: Book One of The Rhenwars Saga Preview
Darkstory
Dark Thoughts
Dark Veil
DarkVoid: The God of Death
Darkwalker
Dark Warlock
Dark Weaver: First Apprentice
Dark Wind, Icy Snow - (RyuTar, YinYuan) [BL]
Dark Wizard's Case. LitRPG series
Dark Wolf
Darkworlds : London
Data Dragon Danika
Date of Dawn
Dating a Witch
Dating Trials of a Vampire Queen
Daughter of a Dark God
Daughter of the Red Queen
Daughter of Yser
Dauntless Star
David The Gray Mage
Davram Who Sings
Dawn
Dawn Dead (HIATUS)
Dawnlands, A New Beginning
Dawn of Antiquity
Dawn of Darkness
Dawn of darkness(ABANDONED)
Dawn of Discovery
Dawn Of Dragons
Dawn of Gaia Online [Dropped]
Dawn Of Magic
Dawn of Myth
Dawn of Pangea
Dawn of Ragnarok
Dawn of the Abyss: Reincarnation of the Smith
Dawn of the Abyss: Return of the Smith
Dawn of the Apocalypse
Dawn of the Beast Cultivator
Dawn of the Eclipse [Foremerly Known as Soul-Bound]
Dawn of the Gods
Dawn of the Realms: Promised Daughter
Dawn of the System
Dawn_Pour
Dawn Rises
Dawn Weaver - a tale of Dragon Riders
Daybreak
DayDream
Daydreaming magic swordsman
Day in the life of a _______ (COMPLETED)
Days in Feyhaven
DCO- Dungeon Core Online
D-Days
Dead Circus
Dead Copy, Isekai ni Shin no Shujinko
Dead Core
Dead Count Fifty
Dead Dragon's Combat Manual
Dead Earth Online
Dead Emotion
Dead Fiction Still Here For My Own Cringe Worthy Moments
Dead Gods Tell No Tales (Working Title)
Dead In Peace
Dead in the Water: A Dungeon's Tale
Deadliest Sin, Greed
Deadline
Deadly Warfare - The War Between Great Nations
Deadly Zero HP
Deadman
Dead mans tale
Dead Men (Duo-OC SI)
Dead Rising
Dead Soul
Dead To You
Dead under
Dead Universe.
Dead World Online
DeadZone - Synthesis
Dealing with a Certain Fox's Antics
Deals & Destiny
Deal With A Maid and A Bartender
Deal With The Devil
Dear Journal
Death and Dandelion
Death... and me
Death Becomes Him: An Age of Steam and Sorcery Novel
Death Bringer
Death By Crotch
Death by Ex-Girlfriend: Aika Crisis
Death by Ex-Girlfriend: Dawn and Dusk
Death by Ex-Girlfriend: War Cloud
Death By Protagonist
Death Contract
Death Count
Death Cultivator (Cultivator in Another World Vol. I)
Death Drive
Death Embraced
Death Exists Not Under Heaven
Death Fantasy
Death God
Deathgod Chronicles
Death God's Adventure in Another World [Dropped]
Death God's Another World Adventure
Death God's Descent (DROPPED)
Death God System
Death-Guard Rejects
Death Incarnate
Death Incarnate (Completed)
Death Incarnate (Main Story Completed)
Death Is a Reality
Death is Just a New Oppertunity
Death Is Only The Beginning
Death is Pleasant
Death Knight
Deathlands
Death leads to Godhood
Deathless: The Rise of the Unkillable Demon King
Death Lives
Deathly Dawn
Deathly Sin: Devourer
Death Mark
Death Note : A New Story
Death? Not even once!
Death of Humanity
Death Quest
Death's Companion
Death's Crown
Death's Disciple
Death's Door
Deaths Door Online
Death's Embrace
Death's Gate: A LitRPG
Death's Heir
Death's March to God- Book 1: Cosmic Beauty
Death's New Entertainment By Zed019
Death's Oracle
Death's Son Desire
Deathstars
Death Streaming
Deaths Usurper *Sorry Done*
Deathsworn
Death, Taxes, and the Second Law of Thermodynamics
Death Theory
Death, the Savior
Death touch
Deathtouched
Death Visions
Deathwalker
Deathwatch Team Fluff: A Warhammer 40k Story
Death with benefits
Debacle: A Tale of Tails
Debt Star
Decapod
Deception
Dec:Ide
Decide Your Fate Games - R.Malak
Decimating Gods and Demons
Decimation [ Apocalyptic Novel ]
Decimation Mortism
DECK: Annoying Dreams
Deck of Cards
Deck of Souls
Declining Destiny
Decoder;Deconstructor
Decompose!
Deep Ambrosia
Deep Delve
DeepDive
Deeper Darker
Deepest Desire
Deepest Dungeon
Deep In The Heart
Deep Sea Shark
Deep Space
Deep Space Combat School: Nexus
Defender of Lapu-Lapu City
Defending Mars
Defiance of the Fall
Defiant: The Bewitched Demon Hunter
Defiant Will
Definitely Not A Super Tale of A Super Hero
Defying Heavens
Defying World Asura
Deicide
Deities and Mortals
Deity of carnage - Keeper
Deity of carnage - Unholy Kingdom
Deity of the Mist: a Naruto fanfic
Deity: The Beginning
Dekar as Worlds Traveler
Delay of the Demon
Delete
Deleted
Deleted Fiction - Author is Ashamed #3
Deleted Fiction - Author is Ashamed #4
Deletion Cheat(Dropped/Hiatus?)
Delsana
Delve
Delvers
Delvers LLC
Demi-God - A LitRPG
Demigod Battle Royale
Demise of the Gods
Demiurge: The Creator
(DEMO) Colorless vol.1- Phantamoire Enigmata
Democracy in Cultivation World
Demon Affinity
Demon Artificer
Demon Bane
Demon Blood: Book I The Arrival
Demon Blood Chronicles: Emergence (Book 1)
Demon Bride
Demon Contractor Unknowingly Becomes Less Of A Jerk
Demon Dungeon
Demon Forever
Demon Gf
Demon Heart
Demon Hero
Demon Hero Reaper Saviour
Demon Hunter Rolland
Demonhunter Zecruix
Demon Hunt: Revenge of the Orphaned
Demonic Arts
Demonic Descent
Demonic Dungeon
Demonic Dungeon Uprising
Demonic Fire Cultivation
Demonic Inscriptor
Demonic Intervention
Demonic Souls of Nature
Demonify
Demon in the magical world
Demonization
Demon King 101
Demon King Or Immortal God
Demon King Reincarnated as the Hero's Child
Demon King's Downfall
Demon King's end (Inactive)
Demon Knight
Demonlordchens Symphony
Demon Lord Cthulhu in another world
DemonLord_Floof – A lack of common sense isekai (COMPLETED)
DemonLord_Floof – The lack of common sense continues
DemonLord_Floof - The lack of common sense isekai
Demon Lord in Angel's clothing
Demon lords? Gods? In this Crazy World, I'll fight them all!
Demon Lord Summoning
Demon Lord teaches his son how to deal with Heroes
Demon Lord try to be Human
Demon of Metal
Demon of the Darkest Night
Demon of the Mind: Cannibal
Demon Of War
Demonology For Morons
Demon Power Ups
Demon Prince Familiar
Demon Queen's Life
Demon Saga - Phoenix Dancer
Demon's Country Protector
Demon's Journey
Demon Slayer: The Kamado Legacy
Demons of Zenora
Demon's Sinistra
Demon's Sinistra - Arc 1
Demon vs. Angel
Dennis the Conqueror (Sword & Sorority Book 1), A Harem Lit Fantasy Novel
Denouncer of Fantasy
Densetsu: A Beautiful Day
Denying fate : path of the dark paladin
Deployed to Destiny: Elite Force in Another World
Deployed to Destiny: Elite Soldier in Another World
Depravity and Debauchery in the Southern Kingdoms
Depth's of Enhancement
Derelict
Derelict Beginning.
Dergons
Descend
Descendant of Dawn
Descendants of the Divine
Descent Into Entropy
Descent of the Strongest God
Desert Conquerer
Desert Odyssey
Desert Wanderer
Designation: M4R10N3TT3
Design of Hope
Desire
desired ERROR
Desire Dystopia
Desires Of Man
Desolated World
Desolate Ruler
Desolate Stars
Desperate Hope
Despite not Being a Hero, Saint, or Even a Demon King, I was Summoned
Despotic Heart
Destinatus
Destiny
Destiny Dice
Destiny: Infernal
Destiny: Infernal [DISCONTINUED]
Destiny Monogatari: The Hidden Object S1
Destiny Online
Destiny Roads
Destiny's Forge
Destroying the storyline in Xianxia!
Destroy The Heavens!
Destroy your new life, repair it, destroy it again by doing crazy things while screaming YOLO!
Destruction
Destruction Angel Summoned From Being Dead For 500 Years Finds Love
Detective Karma
Deus Ex Alice Madness
Deus ex Aliis Mundi
Deus ex Machina
Devastation
D+E - Vertigo's Scent
Deviant
Deviant Crown
Deviant Crown [Complete]
Deviant's Masquerade
Deviant's Masquerade: A world of Heroes, Villains, Rogues, and Family
Deviant's Masquerade: Huntsman's Quest
Deviant's Masquerade: The Huntsman's Quest
Deviant's Masquerade: The Huntsman's Quest (A hero's CYOA origin)
Deviation
Devil
Devil Cultivator in a Ability User World (Hiatus/Slow Release)
Devil Cultivator in an Ability User World
Deviled Egg
Devil Inside
Devil of the Heavens
Devil Park Island
Devil Princess Reincarnation
Devil's Daughter
Devil's Doll Reincarnation
Devils Knight
Devils Out of Inkwell
Devil's Rise
Devil's System
Devil's World
Devine Intrusion: The Demonic Repentance
Devious Dungeon [Dropped]
Devotion Of An Immortal
Devour
Devourer
Devourer of All (Blood of the Ruler)
Devourer of Destiny
Devourer (seint)
Devouring Creation
Devouring the Gods
Devouring The Universe Begins With Reincarnating As a Snake
Devour: Shiver Online
Devour The Cosmos
Devour the Stars (Blood of the Ruler)
Dex's Adventure Through The Elemental Nations (Completed)
Dexs/ Clairs Adventure
Diabolic Gamer
Dial (Ben 10/MCU SI)
Diamonds of the Past
DiamonFTW's collection of OneShots
Diary Log of a Ghost
Diary of a Dungeon Master
Diary of a Mad Vampire
Diary of an Insomniac
Diary of a reborn witch
Diary of Discord
Diary of Erica Kron
Diary of the Night Demoness
Diary of the Shadow Queen
Diasori Dynasty: The World's Last Heroes
Dice
Dice of Infinite Fates
Dice, the cube that changes everything: Roll for Initiative
Didactic Duplicate
Didalam Dunia Raja Iblis
Did U Get The Code?
Died and Went to Manga
Different
Different Point of View.
Different World Along System One Punch Man
Different World along with One Piece System
Different World Reincarnation God Cheat Harem
Different Worlds
Different World with Save and Load: A Horror Story
Dig a Little Deeper
Digging Holes
Digimon Empire
Digital Demons
Digital Haven
Digital Immigrant
Digital Magical Scientist
Digital Marine
Digital Me
Digital Me - Angels and Devils
Digital Sorcery (A LITRPG Adventure Series)
Digitized
Dìle
Dilecto the happy skeleton
Dim(5,5,5)
Dimensional Break
Dimensional Colleseum
Dimensional Demonic Phoenix
Dimensional Intersection
Dimensional Mage(?)
Dimensional Paradise
Dimensional Rift
Dimensional Wars
Dimensión Desconocida
Dimension Eaters
Dimension Extra
Dimension leapers
Dimension Mage
Dimensions
Dimensions intersection
Dimensions of love
Dimension Space - A Dungeon Core Novel
Dimension System
D-INJECT Second Birthday
Dinosaur Reborn
Dio, Rise to the top [working title]
Dipp's Uncertain Adventure
Direction and Magnitude
Director, Machine, Paradox.
Dirge
Dirge of Apocrypha
Dirk, and the Black & Orange Catwomen of Betelgeuse VI
Dirt Magic
Dirt Magic (HIATUS)
Dirty Romance
*DISALLOWED* The Light and Ages Saga: Reference Books
Disappointing and confusing
*DISAVOWED* DemonAge
*DISAVOWED* Descendants: Tales of Half Gods
*DISAVOWED* Fireheart: Age of Shadows
*DISAVOWED* Gemini
*DISAVOWED* Masters of The Elements
***DISAVOWED*** Not A Princess Story
*DISAVOWED* The Machine Saga Vol. 1 Ral'mus
*DISAVOWED* Twilight of the Gods
Discarded Plotline (Discarded Monster)
Discidium
Disciple.
Disciple of a Demon
Disciple of the Dark Arts
Disciple of the Dark Arts (Old Draft)
Disciple of the Evil God
Disciple of the Sword God
Disciples of The Strongest
Disconnected
Dis/Connection
Discontinued
(Discontinued)
(Discontinued) Aevitas - Not an NPC
[Discontinued] After the Fall
[Discontinued] Armus : First Draft
[Discontinued]「Atelier;Magus」
Discontinued-Harems Are Evil!!
Discontinued-Legends of Vale Academy
Discontinued-The Fox With No Tails
Discovering Magic
Disintegrate
Dismissing Darkness
Displaced Emperor Conquering The First Universal Plain
Distance Between Dimensions: Abandoned God
Distance Between Dimensions: Rise of the Summoners
Distant Leaps to Circinus
Distant Leaps to Circinus [Obsolete]
Distortion: A NPC VS Reality
Dive
Dive Deep
Dive in the Afterdark
Diver
Diverge Summoning
Dive Sasquatch God!
Divide and Consume
Divine
Divine Arts
Divine Bladesmith
Divine Change
Divine Construct
Divine Diversions
Divine Dragon
Divine Dragon [Hiatus]
Divine Elementalist
Divine Empress of Chaos
Divine Entertainment
Divine Frontiers
Divine Guardian
Divine Hell
Divine Imperium - Warlord of Takamagahara
Divine Inheritance
Divine Intervention: Cataclysm
Divine Laws of Mind, Body, & Soul
Divine Limitless System
Divine Locket
Divine locket of Hearts
Divine Macabre: The Philosopher
Divine Man
Divine Pagoda Sect
Divine Painter
Divine Progress
Divine Rebirth
Divine Salvation
Divine Shopper
Divine Soul
Divine Souls
Divine Sparks
Divine Time Jewel
Divine Valor Online: Against the Heavens
Divinity
Divinity Reforged
Divinity Skill
Divinity War - The Rise of the Gods
DIZION: Realm of Mortals
Djinn
Dk
Doc
DOC: Northern Light
Doctor in Immortal World
Doctor of Rebirth
Doctor Who: An Alternate Sequel Series
Dodge Tank: A Crystal Shards Online LitRPG Novel
Do Dungeons Dream of Goblins?
Dog-King of the Heavens
Doing God's Work
Do I really have no skills?
Doll
Doll of Death
Doll's Smile
Dolos, god of honesty
Domain
Domain of Man
Domains and Daggers
Domain Warz
DomeNET Online
Dominantion of The Greatest Sovereign
Domination
Domineering Frog King
Domini: An Uprising
Dominion
Dominion Tower
Don't be Mistaken! I'm not a Reincarnate!
Don't Breathe
Don't Burst My Bubble
[Don't Die!]
Don't Do Hidden Quests
Don't Fear the Reaper
Don't Feed The Dark
Dont Know How To Delete So Dropped
Don't label me!
Don't Put All Of Your Short Stories In One Basket
Don't read this
Don't read this you'll die.
Don't Stop Me Now
Don't Touch Me, You'll Die!
Don't Worry, We Have The Best Supporter On Our Team
Doomed Dungeon
Doomed To Be A God
Doomsday 2020
Doomsday Pillars
(Do) Re:Mi
Dormir
Double Edge Hero
Double Rewards for Half the Cost
DOUBLE SYSTEM- Path to immortality
Douglas Sherman's Journal
Doulou Dalu (Soul Land): The 8th Monster
Douluo Dalu - Elemental Fire God
Douluo Dalu Fanfiction: The Journey of Li Tian Tian
Douluo Dalu - Hammer God Douluo
Douluo Dalu - The Legend of the Poison Emerald King
Downfall of Mevobak
Downfall of the Champions
Downfall of the Nanite-Hero
Downloaded
Down the Deep Blue Hole
Down the sewer
Down the sewer (complete)
Do You Ever Wonder How? How This Came To Be?
Draconia
Draconian System
Draconic Blood
Draconic Overlord
Draconic System Ascension
Draconic Transcendence: Cinders and Ashes
Dracula: London Calling
Dracula: Patient zero
Draegish's Light
Draegona Chronicles: Crystals of Andromeda
Draegona Chronicles: Dragon Warriors of Andromeda
(Draft 1- Not Latest Release) Becoming the Protagonist of My Own Delusional World!
Dragged Into a Different World?!
Dragged Into An Isekai With My Friend Being The Generic Hero
Dragged to another world, I sought independence
Dragon?
Dragon Amongst Wolves
Dragon&Dragons
Dragon and Wolf: Two Brothers
Dragon Arts
Dragon Ascension
Dragon Atlas
Dragon Ball Alter: Rise of Little Green!
Dragon Ball, A True Coherent Fan-Fic
Dragon Ball Magic
Dragon Ball:RR
Dragon Ball: Saga Of The Strongest Human
Dragon Ball System
Dragon Ball: Terror of the Gods
Dragon Ball: That Time I Got Reincarnated as Nappa
Dragon Ball: The RPG.
Dragon Ball X The Ultimate System
Dragon Ball X: The Ultimate System [Re-Mastered]
Dragon: Birth of an Ancient
DragonBorn
Dragonbourne
[Dragon child]
Dragon Child
Dragon Child of Thunder
Dragon Claw Evolution
Dragon Contract
Dragon Core
Dragon Cross [Old Version]
Dragon Cycle
Dragon Drudge and Flame
Dragon Fairy
Dragonfall: Enchantment
Dragonfall: Soulborn
Dragon Fantasy
Dragonfather
Dragon Fist
Dragon Fragment
Dragon God
Dragon God Resurrection
Dragon Gods Bride ? I think you have the wrong soul ...
Dragon Gods king / King of the Dragon Gods : Soaring through whole world
Dragon Guardian
Dragon Hack
Dragon Harem Bulletblade King - Strongest Story on RoyalRoadLegends!
Dragon Heart
Dragonheart - Dungeon Ritual
Dragon Heart. Land of Magic. LitRPG Wuxia Saga. Book 6
Dragon Heart. Stone Will. Book I. LitRPG wuxia series
Dragon Hunter Online (DHO)
Dragonic By person
Dragonic Evolution
Dragon in another world
Dragon King *FINISHED*
Dragon, Knight
Dragonknight Chronicles
Dragon Knight Prophecy
Dragon Mage
Dragon Marksman
Dragon Marksman[Short Hiatus]
Dragon Mastery: Daybreak
Dragon Of Coelum
Dragon of Lighting and Steel
Dragon of Lightning
Dragon of the Void
Dragon Princess
Dragon Princess Reborn
Dragon Rising
Dragon Road: How I Rise in My New Life
Dragonscale Online Book One: Gilded Dragon Slayer #6
Dragonscape Online [VRMMORPG]
Dragon Scythe Online
Dragon's Dagger
Dragon's Heart. Stone Will. Book I. LitRPG wuxia series
Dragon Shifter
Dragon Sign: Gold & Glory
Dragon, Silver Dragon
Dragon, Silver Dragon; Revelations
Dragon Skin
Dragon Slaying
Dragon Slicer
Dragons of Dark Rebellion in A World of Essence
Dragons Of The Hidden city
Dragon Sovereign
Dragon Spirit
Dragon's Regalia
Dragon's Rising
Dragon's Road
Dragon's Roar
Dragons, Seapents and Titans
Dragon's Soul
Dragon storm: Beginning.
Dragons Waking
Dragon Sword God
Dragon Throne
Dragon Town
Dragon Wars
Drake
Draugr Cell //Layer 01-- Investiture:
Draugur
Dreaded Duke
Dread Necromancer Of Glyphs
Dreadnought - A Superhero Novel
Dreadnought: Seeking Freedom
Dream and Death are Synonyms
Dreambreaker
Dream; Catcher
Dream Chaser
Dream Connect(Stopped)
Dream Dungeon
Dream Engineer
Dreamer/Leveler
Dream Game: Fighting for my Desires
Dreaming
Dream life!
Dream of Eternity
Dream of the Abyss (renamed)
Dream of the Annihilation Girl
Dream Online
Dreamscape
Dreamscape Beta
Dreamscape (Working Title)
Dreams Come True
Dreams from the Mingled Earth
Dreams of Dust
Dreams of Sabers and Spirits
Dreams of the Dying - An Enderal Novel
Dream to Dream
Dreamwalker
Dream Weaver~ The Cursed & The Blessed ~~( Act. 1 )
Dream Weaver ~ The Cursed & The Blessed (Side Stories)
Dream Weaver~ The Cursed & The Blessed ~( Act.1, Act.2, Act.3 )
Dream Weaver ~ The LightBringer
Dream Weaver ~ World Liberation
DreamWorld
Dream World Online
Dream World Project
Drew Nance, Girl Detective Book 01: The Secret of the Old Clock
Drew's Story
Drezo Regalia
Drezo Regalia: Rebirth
Drift
Drifted Apart
Drifter
Drifting Clouds, Sheltered Storms (DROPPED)
Drip-Fed
Driver Mach 1
Driver: Mach 1
Drive Time
Dromadeir
Dropped
Dropped :(
[DROPPED] City Dungeon Abyss
(Dropped) - Gachapon
Dropped into a Xianxia World
[DROPPED] I threw away the legendary cat ears
(Dropped)The Ancient
[Dropped] The Eighth Child
[Dropped] The Former Cultivator Who Now Plays VRMMORPG's
(Dropped)The God Of Apocalypse
(DROPPED) The Snake of the Fan
[Dropped] The Teacher and Disciple
[Dropped] Truck Driver Reincarnation
Drops
Drugs and Foxtails
Druid
Druidic Cultivation
Druidification
Drunk Dungeon
Drunken Brawler
Drusus The Mighty
Druvik
Dryad
Dryad Relife
Dryad the Hero Hunter
D-Tripper
Dual Cultivation
Duality
Duality of a Soul
Dual Nature - A Harry Potter/Percy Jackson crossover
Dual Nature - A HP/PJ crossover
Dual Rebirth (BL)
Dual Soul
Dual Soul Vol.1
Dual Sword God
Duck and Wolf
Duel Anthology
Du Fyrn Vanyali
Dulled Mind
Dullest Adventure Ever
Dumb Dungeon
Dungeon
Dungeon 42
Dungeon Academy
Dungeon Accident
Dungeon AI
Dungeon Alive
Dungeon and Stars
Dungeon Anfoesol
Dungeon Apocalypse
Dungeon Architect
Dungeon Automation
Dungeon Automation (Hiatus)
Dungeon Avenger
Dungeon - blackjack n' Whooters
Dungeonborn - Double Down
Dungeon Boss Player
Dungeon Chef
Dungeon City Vanskoria
Dungeon Code
Dungeon Conqueror
Dungeon Conqueror [12+] (On Hiatus)
Dungeon core
Dungeon Core: Alex : Hiatuss Infinitetum
Dungeon Core and Dungeon Guide
Dungeon Core/Realm Heart
Dungeon Core Story
Dungeon Corps
Dungeon Corps - Maze of Menos
Dungeon Crawler Carl
Dungeon Crawler Darryl
Dungeon Creator
Dungeon Delve
Dungeon Divided
Dungeon Ecology
Dungeon Engineer
Dungeon.exe
Dungeon Games
Dungeon God
Dungeon Guardian
Dungeon Heart
Dungeon Hunter
Dungeon in a xianxia
Dungeon Instinct
Dungeon Island
Dungeon Isolation
Dungeon Life
Dungeon Life: Redux
Dungeon Madness
Dungeon Mage
Dungeon Maker
Dungeon maker out of the dungeon
Dungeon Maou
Dungeon Master in a New World
Dungeon Master Life In Another World!
Dungeon Mastery
Dungeon Merchant
Dungeon Misfits
Dungeon monster (dropped)
Dungeon Oasis
Dungeon of Apples? (Completed)
Dungeon of Beginnings
Dungeon of Destruction
Dungeon of Horrors
Dungeon of Horrors: Flesh and Blood
Dungeon of Ideas
Dungeon of Immortals
Dungeon of Lights
Dungeon Of Mass Destruction
Dungeon of Night
Dungeon Of Storms
Dungeon of the Dark Wilds
Dungeon of the Dead.
Dungeon of the Dead [hiatus]
Dungeon of The Deleterious
Dungeon of the Divine Goddess
Dungeon of the mindless
Dungeon of the Mountain
Dungeon of the Northern Lights
Dungeon of the Stolen Soul
Dungeon Of the Void
Dungeon of Trees and Thunder
Dungeon of Yanabie Oasis
Dungeon Pearl
Dungeon Quest Online
Dungeon Rails
Dungeon: reaching for her
Dungeon Realms
Dungeon Researcher
Dungeon: Rise or Fall
Dungeon Robotics
Dungeon Runner
Dungeons & Demons
Dungeons & Monsters
Dungeons and Adventurers.
Dungeons and Demons inc.
Dungeons and Dim Hallways
Dungeon's Ascension
Dungeons, Dungeoning, and Duty (On Hiatus, probably going to be dropped)
Dungeon Sect
Dungeon Seekers
Dungeon Ship (Ash Rising)
Dungeon Siege
Dungeon's Legacy
Dungeon Sniper
Dungeons of the Abyss and the Unchosen Heroes
Dungeon Soul
Dungeon's Path
Dungeon Spirit
Dungeon Story
Dungeons. Why You Might Ask? Because I Can!
Dungeon System
Dungeon Tale
Dungeon Tales: Lands of the North
Dungeon Tower Babel
Dungeon Trope Story
Dungeon: (Unknown entry)
Dungeonverse
Dungeonwars
Dungeon Wars
Dungeon War: The Rise of Unknown Dungeon
Dungeon Without A Name
Dungeon World Creator Online
Dunrealm : The Chronicles of the Wanderer
Duology Dark
Duology: Light
Duolou dalu:another story
Duplication Gods
Durandel Online (DO)
Duskblade
Dusk God
Dusk of mythology. *Hiatus*
Dust
Dust to Dust
Dusty the Demon (On Hold, possibly indefinitely)
Dvati
D.W
Dwarven Steel
Dwarves of Appalachia
Dwelling Souls - Story Of A Forgotten Wanderer
Dying Dungeons: Dead Kings & Mad Queens.
Dying was harder than medical school until someone pushed me down the stairs.
Dynasty's Ghost
Dysphoria
Dystopia
Dystopia Against Fantasy
Dystopian Dictator
Dystopius
Each Determined Child
Eadenara Online
Earth 2.0
Earth 402
Earth AA
Earthen Journey
Earthen Lord
Earthly Treasures Pavilion
Earthly Treasures Pavilion [Discontinued]
Earth Moving Out
[Earth Reborn]
Earth Sage Doesn'T Want To Be Bothered
Earth's Core
Earths Eulogy
Earth's First Dungeon
Earth's Golden Age: The 100 Day Quest, Book 1 - A LitRpg series
Earth's Hydra
Earth's Second Evolution
Earth's Uprising
Earth Tactics Advance
Earth: The Gods' Playground
Earth to Rae
Earth Warriors
Earth XIV
Eat
Eat and Grow Strong (Old)
Eaten By A Slime?!
Eater
Eater of Spirits
Eating Fast Is My "Overpowered" Ability
Eating Fast Is My Overpowered Ability
Eating Gods, Becoming Beasts
Eau de Toilette
Ebon Bolt
Eburnean Passage
Eccentric Soul - Rebirth Into a Fantasy World.
Echo
Echo Black
Echoes
Echoes (hiatus)
Echoes of Ruin
Echoes of Rundan
Echoes of the Mirror
Echoes of the Past Long Gone
Echo of Earth
Echo Valley (Updates Wednesdays)
Eclipse Online
Eclipse Online: [Spoon] the Dimension Thief
Eclipse: Rise of a Demon King
Eclipse: The Undying Legion
Economicalopoly
Eczius
Edea Chronicles: Hero Summoning Conspiracy
Edean World Online
Edelinferno
Edenawe by Rulpra
Eden Garter, Dragon Anomaly
Eden no Sekai
Eden Virus
Edge of Apocalypse
Edge of Chaos
Edge of Eons
Edge of Magic
Edge of Reality (Phantom Server: Book #1) by Andrei Livadny
Edict
Educating E.T.
Efatra
Eh? I am Supposed to be Dead But Now I Get a Deadline !?
Eh! Where Did My Pen... Pen... Go!?!
Eidolon : Martial Familiar
Eigengrau
Eight
Eight-Bit Bastards
Eight God Engine
Eighty Year Old Cultivator
Eijia
Einder Bloodline
Ein Gard
Einherjar
Eirineftís
Eir - The Immortal
Ekalius Online
El Aventurero Maldito
Elbard's Uproar(Dropped)
Eldergrove
Elderia - Dawn of Creation
Elder Lich Saga
Elder Scrolls: Naruto
Elder Scrolls: The Master
Eldest Son of the Heavenly Emperor
Eldingar - The Lady of Golden Steel
El Dorado
Eldritch
Eldritch Cultist
Eldritch Cultist In Another World
Eldritch, Fragments from the Abyss
Eldritch Maiden
Eldritch Night
Eldritch overlord
Eldritch Rebirth
Eldritch Rebirth (Original)
Eldritch Rebirth (Rewrite)
Eldritch Sorrow
Electric Eastwood
Electronic Pulse
Electrosilver
Eleeah
Elemental Chrysanthemum Homeland Online
Elemental Duelist
EleMenTaLenT : A Dungeon Keeper's Tale
Elemental God
Elementalists
Elemental Knights
Elemental Monster Tamer
Elemental Nations: Oni from the Leaf
Elemental Ninjas
Elemental Online
Elementals
Elemental School of Hard Knocks
Elementals: Crystal Garden
Elemental Soul
Elemental Sword
Elemental Swords
Elemental Trinity: A Harry Potter/Pokémon Fusion
Elemental User in the world of one piece.
Elemental Warrior
Elemental World Chaos
Elementarem Vim
Elementia Online: Way of Aer
Elementium
Elements of Reality
Elements of War- Fireborn: The Flames of War
Element Zero
Elena from Hell (Volume I)
Elf anew
Elf War Online
Elgnis
Eliminator
Eliona's Gate: Hesitant Healer
Elitian XVI
Elizabeth, Elizabeth
Elm's Horizon
El Presidente is a dungeon core!
Elrich Saga Yellow Springs Book One
Elsa's Journey To The East
El Sexorcisto!
Elskria Online
Elswynd
Elten wars
Elten wars (Hiatus)
Elurias
Elutheria: Adventures of a Recluse
Elven Garden
Elycian
Elysium
Elysium: Diamond In The Rough
E = Magic Squared
[Email Protected]
Emancipation - An Isekai Story
Embargo
Ember
Ember in the Ashes
Embers
Emblem Above
Embrace of the Ancients
Embrace the Blade
Embrace the Blade [Dropped/Old]
Embrace the Ether
Embracing Death
Embracing the world with happiness!
Emerald Forest
Emerilia
Emily's Diary
Emotionless Pain
Empathic capacity of a teaspoon
Emperor
Emperor Magus
Emperor NPC
Emperor of All
Emperor of Blue Flower Mountain
Emperor of Death
Emperor of Heaven
Emperor Of Myraid Planes
Emperor of Soul Pets
Emperor Of Space and Time
Emperor of the Cultivation World
Emperor of the Demon race
Emperor Of The End of Times
Emperor of the Era
Emperor of Yin and Yang
Emperor Saga
Emperor Saga : Slaves Covenant
Emperor's Ascent
Emperor's Journey
Emperor's Reign
Emperor's System
Emperor (皇帝)
Empire at War
Empire Building System
Empire Haven Online
Empire in Crisis
Empire of blood and steel
Empire of Death Saga: How A Sword changed my Life
Empire of Glass - The Heroic Legend of Heron
Empire of Salt
Empire of Souls
Emporium of Awesome
Empress is now LIVE
Empress of Blue Flower Mountain
Empress of the Lost Realm
Empress Reborn
Empress's Emprise
Emptiness - The Saga of the Void Hero
Empty as tomorrow
Empty Promises
Empty Promises [Cancelled]
Empty Promises [Hiatus]
Empyrean
Empyrean Ascent
Empyrean Blade Kira
Empyrean Ice Emperor
Emulation of chronology
Enable Evolution
Enchanted: Past, Present and Future
Enchanter
Enchant Gunner: Bullets and Magic
Enchanting
Enchanting Pays Way Better!
Enchantress: Pathways Through Darkness
Encroaching Darkness
End
Endborn Creation
End Boss
Ender's Adventure!
EndGame Online
Endless
Endless cage(Dropped)
Endless Dungeon
Endless Expanse Online
Endless Fantasy
Endless Fight
Endless Journey: Infinite Realms
Endless Lands
ENDLESS MYTH : Surpassing the Gods
Endless Online: Oblivion's Blade (LitRPG)
Endless Online: Oblivion's Promise (LitRPG)
Endless Path : Infinite Cosmos
Endless Possibilities
Endless Prosperity
Endless Samsara, Limitless Nihility
Endless Stars
Endless Universe
Endless Waltz
Endless Worlds
End of Civilization, First Emperor.
End of My Boring Life
End of Tales: Gaia
End of the World
End World
Energon
Energy
Energy Animals
Enganar
Enganar - The Watcher's Tale
Engineer Army
Engine: Online
Engraver
Enhanced
Enjoying My Second Life in a Fantasy World
Enlightened Empire
Enlightenment
Enlil, the Immortal
Enor
EnRich
Enru: Accursed Child
Ensis Core
Enslaved by the System
Entangled Fates Book 1 - Quantum Beginnings
Enter Darkness
Enterria
Enter the Storm
Enter the System
Enter The Warlock
Entferner
Enthralled: Book 1 - The Crystal Heart
Entity
Entity(dropped)
Ent of Pyromancy
Entries and Logs.
Entropy
Entropy (Formerly: Who exactly Am I?)
Entropy's Servant
Envy
Enyatta; Daughter of the Library
Eoum: The Tenth Summon
Ephemeral: A Journey of Souls
Ephemeral Cycle
Ephemeral Shards
Ephemeral World
Epic of Caterpillar
Epic of Esloria
Epilogue
Epiphany of the Weak
Epiphany Online
Episode 01: Enter Annwyn Online
Epitaph of Everything
Epoch
Epoch of Humanity
Equilibrium
Equilibrium (Crypto)
Era of Creation
Era of Genocide
Era of Mutants
Era Of The Kobold
Erased
Eraw : The secret raven
Ercse0
Ered Kilmah, Overlord
Ereidien
Eretriah online. A LitRPG book.
Ergon V
Ericverse
Ero Dungeon Evolution
Ero Dungeon Evolution (RR Edition)
Eros Libera
Erroneous Quest
Error
Erthen Chains
ER Vol. 1: Emergency Rabbit
Escape
Escape - A novella set in the universe of The Net
Escape from the Dungeon
Escape From ZAN YIDEA
Escape The KNIGHT
Escape the Room Game #1 - The Bedroom
Escaping the Box
Escaping the System: Avoid Death at all Costs
Escapist
Eskion -god of all
Esoteria: The Planes of Man
Esper
Esper In Magical World
Esper Online: The 15 Thrones
Espers
Esper: Search for Power
ESP Escapades
ESPU:Zero
エッセンス (Essence)
Essence of Ash
Essence of the Dragon
Essence of the unRaveled
Esyr, the First Fae Dragon
Eternal
Eternal Awakening [LitRPG] [EtA Book 1]
Eternal Battlegrounds
Eternal Beloved
Eternal : Bloodborn
Eternal Bones
Eternal Champion Book 1: Divine Diversions.
Eternal Chronicles: Vampire
Eternal Conflict
Eternal Divinity
Eternal Dream
Eternal Fantasy
Eternal Freedom
Eternal Harvest
Eternal Horizon
Eternal Ice Mistress
Eternal Kingdom : A Gift From A Loving Brother in A VRMMO World
Eternal lord
Eternal Lullaby
Eternal Magneta
Eternal Mana
Eternal Pact *DROPPED*
Eternal Payment - Angelic Guns and Magic
Eternal Peace And Chaos
Eternal Pheonix
Eternal Plunderer
Eternal Regalia
Eternal Saga : Book One - The Beginning
Eternal Soul
Eternal Succession
Eternal Teacher
Eternal Wind
Eterna's Source
Eternia Memories: 2+X
Eternia Rising : Lost
Eternity
Eternity Online, a military sci-fi GameLit Fiction
Eternity's Wake
Eternity Wars 1.0 (Dead Version)
Eternity Wars V1 (Dead Version)
Ethan's Shield
Ethereal Bodies
Ethereal Creator of Realms
Ethereal Heavens: Genesis
Ethereal Reality
Ethereal's 13 Worlds
Ethereal Sovereign
Ethereal Space
Ether Flows
Ethos - a KTS novel
Ethria: The Pioneer, An Epic LitRPG Adventure PROMO
Et Non Lucem
Etryria [discontinued]
Ett Tu Tre
Eulalia's Adventure
Euphoria
Euphoria [DISCONTINUED]
Eusocial
Euterpe Online
Evangeline
Even a Hero Needs a Vacation Every Now and Then
Evenfall
Even if the World is Against Me
Evening Shadows
Even in the afterlife, I still hate mondays ...
Even the heavens will shudder
Event Horizon
Event Horizon (S5)
Eve of Gods
Ever After
Evera: Mourner's Isle
Evera: Mourner's Isle [HIATUS]
Everdell: A Critters Tale
EVERFIRE Online
Everlasting Soul
Everlasting Struggle
EverLast(Stopped)
EverSense...Offline?
Everworld
Everybody here is a cultivation idiot.
Everybody Loves Large Chests
Everyday Life As A Prison Guard
Everyday normal violence
Every Grain of Sand - The Shivered Sky Part 1 - A tale of the war between the angels and demons
Every Hero's Thorn
Every Hero's Thorn (Hiatus)
Everyone Else is a Fantasy Character
Everyone is my friend
Everyone Loves Fluffy Tails
Everyone thinks I'm an NPC
Everything is Worth Killing (A Post-Apocalyptic LitRPG)
Everything Needed to Build a Fantasy World in Countless Easy Steps
Everything's Price
Everything will be my way!
Every Time I Sleep, I Die
Eve to Eternal
Evil Dragon on Paper
Evil Genius: Ascendance
Evil Goddess System
Evil God Mafia
Evil God Slayer - Vampire Lord
Evil Incarnate
EvilLive
Evil Overlord?
Evil Overlord: The Makening
Evocatus
Evo-Gaming
Evolution Arts
Evolutionary Prison
Evolutionary Slime (Dropped)
Evolution Barricade
Evolution- From the Bottom to the Top
Evolution-From the Bottom to the Top
Evolution God
Evolutionist
Evolution of a Ball of Light
Evolution of a Cultivation Beast
Evolution of the Lazy Gamer by Bruticus
Evolution of the Living
Evo:lution online
Evolution-revolution ! ( On Hiatus.... I will never give up... just need time. )
Evolution (Rewrite)
Evolution's Choice
Evolution. Starting point: Worm
Evolution System
Evolution System+Customisation System=Stronger System? Maybe not though...
Evolve
Evolve, Adapt, and Kill.
Evolve and Adapt
Evolved
Evolved: The Apocalypse of White Light
Evolve or DIE !!
Evolve: The Scourge Wars Book 1
Ewan story
Exalted Immortal Emperor
Exalted Toxin Lord
Exalted Warlock
Exceed System
Exceed System: The Gambler
Exceptional Normalcy (A Pokemon Fanfiction)
Excitement Turned Real
Excursion
Excursion Book 1, The Goblin Curse. First arc.
...Excuse me, but how do you expect me to defeat the Demon Lord when I only know how to heal..?
Execute Order D20
Executioner
EX: Emblem
Exhuman
Exiled Nomads of the Galaxy
Exile Online
Exiles
Existence
Existence of The Irregular 2 - Reincarnation
Exitium (dropped)
Ex Machina (Hiatus)
Ex-mob boss in another world
Exodus™ Online by B4DDI3Z
Exodus: The Assassin's Path
Exorcism 101: Where Love can Cure Ghost Possession
Exosolar
Exousia
Expanse
Experia Online
Experiment
Experimental Dungeon Novel
Experimental human in the new world
Experimental Omnipotence
Experimental Wuxia Novel
Exploit
Explore, Search, Hunt
Exponential Mana Regeneration
Expressionless?
Exrenity
Extant Expanse
Exterminator Dungeon
Exterminus - Restart
Extinction
Extra character at irregular magic highschool
Extra Life Online
Extrasensory Perception System (EsPers)
Extreme Heights: Face Your Fear
Extreme Sports!!
Exubera
Exuperius
Eye from the sky: The Journey of Thaim
Eye of Adventure
Eyes Full of Sins
Eyes of Eunos - a Kammi Kettu story
Eyes of passion
Eyes of Time: New World
Ezekiel, an Angel in the multiverse.
Fables: The Forgotten Legends
Facade
Faceless Phantom
Faceless: The Monster Within
Face your Fate
Facilities and monstrosities
Facticity
Factions at War
Faded Grey
Faded Hours
Faded World: The Island
Faerwald - Rise Above
Faery Knight - A Mirai Suenaga Adventure
Fafner the greedy dragon
Failed Creation
Failed Dungeon Inn
Failed Hero
Failed Suicide
Failed World
Fair Princess
Fairy Hunt
Fairy Tail: Fubuki
Fairytale of Mine
Fairy Xia Yu Manual Pampering the Beautiful Harem
Falcon Punch
Falene Fantasy: The Undying
Falgreys
Falknir - Rising From Ashes
Fallacy of Fate
Fallen
Fallen Apostle
Fallen Celestial ~ Traveler Of Worlds
Fallen Crow
Fallen Divine Online
Fallen Eleven
Fallen From Grace - Blood Beginnings - Book 1
Fallen from Heaven
Fallen from the Moon
Fallen God decides to live a little
Fallen Immortal
Fallen Star
Fallen star - A Dragon's tale
Fallen Throne
Fallen World (The Dark Enemy)
Fall For Me
Fall From Grace.
Fall From Grace - The Prequel
Falling from Earth
Falling From Grace, With Style
Falling in love with a witch
Falling in Love with The First King
Falling into Crazy!
Falling Petals
Falling rain
Falling Star of Evolution
Falling Upwards
Fall of Jupiter
Fall of Man
Fallout: The Gamer
Falnen
False Dendrite -heaven shouter-
False Prophecy
Familia: Ang simula
Familiar
Familiar In Chains
Familiar's Chronicles
Familiar Things
Family Matters
Family of abnormalities
Family of Fiends
Fanfic Ideas
Fangs
Fang the Iron Chef
Fantasia
Fantasial Apocalypse
Fantasial Rise
fantasial rise [HIATUS]
Fantasia Online [VR Game]
Fantasia Saga - Book 1: Rise of monsters
Fantasia: The odyssey of magic
Fantastic Advancement
Fantastic Darkness
Fantastic Journeys Through the Stars
Fantasy and Terror Klepto's Harbinger
Fantasy Annihilation
Fantasy Collision
Fantasy Craft Online: Donny Opens a Strip Club in Another World
Fantasy fugitives (Hiatus)
Fantasy Hitman
Fantasy In A Turtle's Shell.
Fantasy Inbound
Fantasy into Fallout
Fantasy Mecha Online
Fantasy Mecha Online (Cancelled)
Fantasy Online: Hyperborea
Fantasy Road Trip
Fantasy Royale
Fantasy Unlimited (Dropped)
Fantasy Vs Technology
Fantasy war
Fantasy wishes
Fantasy World Adventures
Fantasy world Domination
Fantasy World Epsilon 30-10
Far Behind
Farblade
Farmer's Dungeon
Farming For Gold
Farm Life
Faroutposts
Farseer
Far Strider
Fast Food in Another World
Fatal Chapters: A Guide to Piloting Gods
Fatal Cries
Fatal System
Fat Boy Hero
Fate
Fate and Chance
Fate: A Short Story
Fateburn: Chaos uploaded(ABANDONED)
Fate Cannot Bind Me
Fate CON-trol
Fate Destroyer
Fated Realms: A Tale of Two Siblings (Working Title)
Fated Sword
Fate Epsilon
Fate/Negative
Fate of Maggot
Fate Online
Fate Online (The Demonborn)
Fate Overcharge (Stalled)
Fate/Regalia
Fate/Resurrection
Fate's Assassin *dropped*
Fate's Choice (ABANDONED)
Fate's Fortune
Fate's Slave
Fate/Survivor
Fath dungon
Father at 15
Father of Monsters
Fathers Bury Sons
Fayde of the Void (OLD VERSION)
Fayde of the Void: The Immortal King
Fayte
Fear: Ever-Changing and Evolving
Fearless
Fear Rune - The Abandoned Realms
Fear system
Fear the Netherlands
Fear the wrath of the spider
Fedora/Katana
Fei Cai's Ascension— Reverend Insanity
Feirut's One-shots
Fei's prophecy
Felicia's Second Life
Felicitas
Fell Deeds
Fell down into a dungeon
Female Immortal's Return to Earth
Femalekind
Femalekind Book One (Complete)
Femalekind Book Two
Female mage, a Baker, and a kingdom
Female Martial Empress
Femme Fatale - An Element On the Run
Fenrir Rising
Feral - Evil is a matter of perspective
FeralHeart
Feral Shadows
Feral: The Story of a Half Orc
Fermi Paradox
FFO - Free Frontier Online (on hiatus)
Fiction
Fiddler in Another World
Fidget Spinner Cultivator
Field of blood
Field of Machines
Fields To Fights
Fifth Dimension
Fifth Life: Scarlett
"Fight!"
Fighting Back The Tide
Fighting Fantasy
Fighting for the Lord of Earth
Fighting God
Fight the System
Fight To Live Another Day
File's Cor
Filth: Soiled Destiny
Filthy Casual
Final Boss
Final Destiny Online
Final Earth
Final Hour
Final Light
Finally a competent lord
Final Monarch
Final Quest: Restore The Lost Data
Final Rebellion
Final Stand
Final War
Finding Destiny
Finding Home: The Quest for Knowledge
Finding Inner Peace In A Cruel World
Finding Magic
Finding Stardust
Fingertips
Finley- Diary Entries
Finley- The Lost Prince
Firakha - Of Monsters And Gods
Fire and Blood
Fire and Shadows. Legend of the breaker.
Fire Away
Fire Breather
Firechaser
Fire Emblem: Blazing Sword
Fire Emblem: The Lion's Blade
Firefall
Fire in the Blood
Fire Lord Seti
Fire of a Dragons Heart
Fire Rider
Firestorm Monkey
Fireteam Delta
Fire within
First
First Academy
First & Last
First Bite
[First Draft, Moved] Of Astral and Umbral
First Love
First Of My Kind
First RE:Guards
First Vampire
First Waves
First World of an Idle Dreamer
Fishing Priest
Five Elements Academy: A Tale Of Magic
Five Knives
Five souls, 1 body
Five Squared
Fjorgyn: A Rebel Rises (Complete)
F**k Me! Hate Me!
Flags of Rebellion
Flame-Eyed Immortal
Flames of Dawn
Flames of Divinity
Flames Within the Heart
Flaming Light
Flaming Phoenix
Flashback: Siren Song
Flash Step
Flavour
Flawsome
Fleeting Flight
Flesh and Metal
FLESH: Distorted Soul
Flesh runes
Fletch!
Flick Jumper
Flight of Icarus
Flight of the Princess Sage
Flight of the Princess Sage [hiatus]
Floraling Secret
Floriena: The Start of a Journey
Flow
Flowered Metal
Flower Girl
Flower in Ice
Flowers Before the Dragon
Flowers Bloom from Battlefield
Flowers change
Flowers From a Dark Lord's Fall
Flowers on a Broken Path
Fluff-san in the Human World?
Fluffy Tails and Horned Heads
Fluvia Dellarose was an Otome Game's Villain
Fly in Fantasy
Flying City of Lavender : Search for the Humanity
Fly With Us
Fodder
Foe of Reality
Fog of War
Folgore
Follower Of Death
Followers of The Way
Follow the Reaper
Folly of Heroes
Foodie's Enigma
Food Revolution in the other world
Fools of Fate
Fool's paradise (dungeon novel)
Football System
For Adult Only (FAO)
For All In Thy Hands
Forbidden Book
Forbidden Knowledge
Forbidden seduction
Forced Hero
Forced to be The Villains
Force Invasion
Force Magician in Another World
Force of Nature
Forcer By maskdragon
Foreigner, Journey in a different Kosmos
Foreigner: Journey in a different Kosmos
Foreshadow
Forest
Forest & Human Translator
Forestborn
Forest Born
Forest Dungeon
Forest Dweller
Forest of puns (short story)
Forest of Teeth
Foreststorm
Forever
Forever Alone: Trinity Blade Online
Forevermore
Forever Online - Wanderer
ForeverQuest Online
Foreworlds: A LitRPG story
Forged in Fear and Fury - An Apocalyptic LitRPG
Forge of Destiny
Forge of Heroes and Legends
Forgetful
Forge thyself
Forging a Digital History
Forging his own destiny
Forging The Beastmen
Forgive me, I didn't mean to take that!
Forgiven
For Glory
Forgotten
Forgotten Conqueror
Forgotten Dungeon
Forgotten Emperor
Forgotten Heroes
Forgotten Memories
Forgotten Necromancer
Forgotten Pages
Forgotten Quest
Forgotten Reincarnation in another world
Forgotten Undead
Forgotten Weapon of War
For Grass and Glory
For I Am Legion
For I will…
For Justice! - A Tale Of Paladins And Hammers
Fork This Life!
Former Demon Lord's Travels
Former Ice Princess
For Perverts Only
Forsaken
Forsaken Blood
Forsaken Core: Awakening
Forsakendeva
Forsaken Hope
Forsaken Soul
Forsaken Talents: A Dark Path
Forsaken Warrior - A LitRPG Adventure
Forsaking Reality
Fort Geranium
For the Hoard
For the Man who had Everything
For There is Will
For The Right Price
Fortress Seven
Fortuitous Mage
Fortuna in Theatrum
For Verania!
Forward is The Day
For whatever reason, I seem to have reincarnated.
Foundations of Magic
Founding Eden
Founding of Humanity - Animalist
Fountellion in The Spiral (kindle) - The Nature of the Game & Progression One
Fountellion in The Spiral - Progression One
Fountellion Sessions in The Spiral
Four Rhytm Across The Blue DJ - Fly For Once More
Four times I've died, the fifth was intentional
Foxes among Wolves
Fox girl in another world
Fox-girl Reincarnation
Foxglove Fantasy
Fox Tail
Fox With System
Foxxy girl in another world
Fractures: A City Asunder
Fracture: Tales of the Broken Lands
Fragility
Fragmented Reality
Fragmented Realms
Fragment of Space
Fragments Of Aeon
Framework: Monsters & Legends
Framework: Monsters & Legends
F:Ran
F-Ranked Cultivators in an F-Ranked School
Frau NoSur
Frayed
Frays in the Weave
Free
Free: An Unbound Soul
Free Characters For Others
Freedom
Freedom Fantasy
Freedom in the New World
Freedom Online
Freedom : shadow of sins
Freedom Universe
Freedom: Virtual Reality Evolved - (Codename: Freedom Trilogy)
Free Empire Online
Free Fanfic ideas
Free Flight
Freelance Saga
Freestyle [DROPPED]
Free World Online
Fresh Blood
Freude (Hellsing Ultimate/RWBY)
Freya
Fridays (Continue) Online
Friend?
Friendly Neighborhood Necromancer
Friend Of Beast, Enemy Of Man
Frigid Influence
From A Delinquent To A God in 10 Minutes
From a Neet, To The Emperor's Wife, To.....Eh, The Demon Overlord?!
From an Endless Time and a Countless distance
From a phoenix to a dragon
From a World of Fantasy to a VMMORPG
From Bards and Poets
From Beast to Man and Back Again
From Boy to Man
From Chief to the Emperor
From cripple to hero!
From Death I am Reborn: Chaos will Follow
From Dreams to Magic
From Dreams To Reality
From Dust
From Earth to Xianxia world
From farm to MMORPG world
From Fire: Birth
From Fish to Dragon
From FPS Game to Another World
From God to goblin
From gun to sword
From My Enemy to My Love (bxb)
From Normal Student to Strongest Being
From nothingness
From One War, To Another
From Paladin to Pawn [HIATUS]
From RPG-like World to a Xianxia World.
From Sanity to Calamity
From the Ashes
From The Black Abyss: A New Frontier
From The Black (dropped)
From The Earth To The Sky - A Short Story Collection
From the Final World
From the ground up
From the Moon: Home
From The Womb Of The Either
From Vampire to Paladin
Frontier Crisis
Frontier of Blades and Walls
Frontrunners
Front Tide
Frostbite - A Kammi Kettu Fan Story
Frost Dragon Cultivation
Frost Iron Forge
Frozen Armies
Frozen Ascension
Frozen in time
Frozen Soul (Completed)
Frustrated godly gaming
Fuji
Full Moon at Daybreak
Fun and magic
Fun in Other Worlds
Fun With Abduction
Fury
Fury: Book One of the Titanomachy
Fused Power
Fusion
Future Magic
Fuuko: The Fox-Masked Hero
Gabriel "The Bastard Son"
Gachapon!
Gacha System
# Gaea 1 - Blood of the Pure
# Gaea 1 - Blood of the Pure (COMPLETE)
# Gaea 2 - Light of the Shadow
Gaethea
Gaia Awakens
Gaia Campaigner
Gaia- Legend of CC
Gaiana: Season One
Gaia's little Gamer
Gaia's Shield
Gaia's will and challenge
Gainers: The chronicles of The Nexus
Galactic Fist of Legend
Galactic Games
Galactic Internet: System Initializing Book 1
Galactic Intervention
Galactic Schizm
Galactic Showdown!
Galactic Waltz
Galal: Horde Master
Galataea Crystallim: Chronicles of the Lonely World
Galataea Crystallim: Redux
Galaxia: A Modern Fantasy! [DROPPED]
Galaxy's Forge - LightHammer Chronicles: Book 1
Galaxy Wars: The Legacy of Light and Darkness
Galbadia Prime Online
Gallanor (On hiatus)
Gambits
Gamble
Gambled World
Gambler's Fallacy
Game Change
Game Changer - Day Dreams
Game Changers
Game Cheater Reincarnated
(Game + Divinity) - Heroics = Our Reality
Gamed:Last Attempt
Game Makers
Gamemaster
Gamemaster's Adventures in another world
Game Master - Unlocked
Game Master - Unlocked (Terror Infinity)
Game Master - Unlocked [Terror Infinity]
Game Master - Unlocked (Terror Infinity) (Old Version)
Game of apocalypse
Game Of Cards
Game of Death Gods
Game of Hell
Game of Reality
Game Of Souls
Game of the Mad God
Game of the Year
Game of Thrones FANFIC: Lycan
Game Of Thrones: Season 8 - The Right Way
Game of World's Heroes
Game On
Game On!
Game Over
Game... Over?
GAME OVER a daily life of a video game boss
Game Over. New Game.
Game Over: Rise of the Gods
Gamer
Gamer Girl
Gamer God
Gamer Kind
Gamer of the Dead
Gamer of the Dead (Europe Edition)
Gamer of the Martial World
Gamer of the Martial World [indefinitely postponed]
Gamer's Guide to Waking up as a Dinosaur
Game? Second autumn
Game, Set, Match
Games of Galdric
Game systems abilities in a fantasy world
Gameworld
GameWorld: Earth's Apocalypse
Game world or A different world?
Gaming God
Gaming King
Gaming Paragon
Gaming The System
Gaming the Tower
Ganda'lfr – The Left Hand of God
Gantzer
Gardener of Immortality
Garden of Ash
Gargoile found the library tower
Garth Online
Gaslgiht
Gast Academy: The Viridian Vipers
Gate Between Fantasy
Gate Guardian - Song of the Frozen Soul
Gate Guardian - Tale of the Blazing Heart
Gatekeeper
Gate keeper
Gatekeeper of Death
Gate of Spirits
Gates of the Gamer
Gate to Utopia
Gate: War of Two Worlds
Gate: War of Two Worlds Part 1
Gateway to Nexus (Dropped)
Gattican Drive
Gears Of Rust (Abandoned)
G.E.A.R - The Study Of Nanomana
Gecko
Gehenna's time ( Hiatus )
Geist
Gems of Fate
Gem Wars - The α crystal
GemZ: Chronicles of Le'Tayah
GENE Project: Path to Perfection
GENE Project: Road to Perfection
General of Darkness
General's Call
Generals of the Apocalypse
General Wife of Dark Emperor: Slow Witted Miss/Droped/
General Wife of Dark Emperor: Slow Witted Miss/Dropped/
Generation: Alpha
Generation Militia
Generic Zombie survival Wuxia Cliche story
Generika 0Ffline
Genesis
Genesis Accord
Genesis: Journey of the Creator
GENESIS PRIME- New Beginning
Geniecide: Genie's First Law
Genius has an Infinite Capacity
Genjitsu no Kyoukai
Genjutsu Made Real
Genophage (Liber Telluris Book 1)
Genso Suikoden: Worlds Collide
Gently Tormented
Geomancer
George Brown and the Uth Stones by Duane L. Ostler
George of the Dungeon
Geo's travels through an unfamiliar continent
[German] RE:HUNDERT -Leben in einer anderen Welt-
Gestalt Hope
Getting a Common Game Ability on Normal Life [Revised]
Getting big in the Big Blue
Getting Hard
Getting power IRL is expensive
GG Newb- A LitRPG Saga ($200 in prizes! Naming contest!)
Ghibli Gang - Where in the world are we?
Ghost alchamist's sinister witch [dropped]
Ghost Girl, Ghost Girl. She Gonna Take Your Soul!
Ghost Gods - Harem Book
Ghostified City
Ghost of the Uchiha
Ghosts in the Glass-- A Lesser Dark: Book II (Complete)
Ghosts in the Glass-- A Lesser Dark: Book II (Second Edition)
Ghosts Over the Forest
Ghosts Within
Ghost World Academia
Ghost World Academia (Discontinued)
Ghoulish insanity
Ghoulish insanity (incomplete/finished)
Ghoul Rising by(Tailspindark)
Giant Eater (LitRPG)
Giants and Demons
Giantslayer
Gifted
Gifted Eyes
Gift of Mercy
Gifts From Morpheus
GIG: God In Gold
Gi: Imera
Gin: A pint of London's finest (Litrpg)
Gina the goblin, Dungeon Extraordinaire
Girl Who Survived The Madness
Girl with the Golden-Cat eyes
Girl with the Golden Eyes
Give me a word I'll make a world
Glass Arrows
Glass Cannon
Glass Cannons
Glass Cannon - the Search for Synergies
GLASS || The Catalysts Series, #1
Glimmer, A Throne of Souls (An RPG Gamelit Novel)
Glints Saga: Papillon
Glints Saga: Papillon - The Story of an Ex-Magical Girl
Glitch
Glóaming of the Gods
Gloomhaven: Glorious Gatherers
Gloominess +1
Gloominess +4: The Cradle of Gods. A LitRPG series: Book 4
Gloria: A Dungeon Delver's Story
Gloria Infidelis -Glory Beyond the Madness-
Glorius Adventure Online
Glory be to Arria
Glory Hole Adventure
Gloryhound - The Story of a Wizard's Assistant
Gloryland
Glory Of The Hunt
Gluttonous little crow
Gluttonous Prince
Glyph
Gnawing Hunger
GNO arms GNO problem!
Goal of a Cultivating Beauty
Gobbo
Goblin
Goblin Artist
Goblin Combe
Goblin Conqueror
Goblin Flood
Goblin Kingdom
Goblin Lord
Goblin Mage
Goblin Memory
Goblin Musicians
Goblin Progenitor
Goblin Rebirth
Goblin Rising
Goblin's Evolution
Goblin: Tower of Gates LitRPG Book One
God Among Men
God Amongst Cultivators
God Among the Cats: Nya Tribe Dominance!
God Blade (Hiatus)
God Chef Rordon Gamsay
God complex
Goddess at the Gates
Goddesses are out of Heroes, so it's up to Me to Save an Isekai World! [Poll Story]
Goddess of Beauty
Goddess of Computation
Goddess of Crystal
Goddess of Death
Goddess of the Anthropocene
Goddess of the Sun and Moon
god Dimension
God Dragon Emperor
Godefiance: Audun
God Era
God Farmer
Godfather of magical technology with a pinch of exortion
Godfather of magical technology with a pinch of extortion
GodForge
Godfrey the Legend
Godhood
Godhood: Info Dumps
Godhood Online
GodHunters
God in Deep
God Is A Game Designer
God Killed Me
Godlea: World of Creations
Godless
Godlike
Godlike Reborn
Godling
Godlings
God looking for love
Godly Otaku Divine System
Godly Otaku System: A Gamelit/Xianxia novel
Godly reincarnation
Godly Stay-Home Dad
Godly System
Godly Voice In Another World
God of All Element
God of all system
God of Chaos
God Of Cheat
God of Crows
God Of Destruction
God Of Disaster
God of Evolution
God of Exemplum
God of Eyes
God of Gnomes: Book 1 of the God Core series
God of Heroes [GoH]
God of Infinity
God of Magic & Martial Arts
God of Magic and Creation
God of Martial Arts
God of Mischief
God of Music
God of Nature´s curse
God of Sacrifice
God Of System
God of the Apocalyptic World
God Of The Arts Book 1: Captive of Alberdos
God of The Criminal's world
God of The Crows
God of the Isekai
God Of The New World
God of Virtual Reality
God of World Creation
God Particles
God Project : Blank Slate
Godpunk: A Tale of Swords, Sorcery, and the No-Good Journalist Who Saw It All
God Rising: The Cult of Ainz Book I
God's Adventure
G.O.D.S. : A Gamelit/Xianxia Novel
Gods and Creators
Gods and Glory
Gods and Men: A litRPG Adventure
Gods and Worlds
Gods Are Watching
Godsbane
God's Beta Tester
Gods Be Wary
Gods Conqueror
God's Death
God's Descent
God's Diary
God's Domain
God's domain (bodyrefiner99)
"God's" Door
God's Door
God-Sent Anathema
God's Eye
Godsfall (Ash Drake Series)
God's Fall Chronicles: Schism
God's fiction (CANCELLED)
God'S For Hire
God's Gambling Table
God's Game
Gods Game
Gods' Game
God's Game : Player [72]
God´s Games
G.O.D.S - Great Overlords Dominating Stuff
Gods How I Hate Nature
God's Island
God's Journey To Be The Best Craftsman
Godslayer
God Slayer
Godslayer (Krndark)
God-Slayers
God Slayer (Vol.1 and Vol.2)
God's Little Joke
Godsmith
God's Orphan
God's Return
God's Seekers
God's System
Godstone
God, Stop that! Chaos Happened When She Became a He. [Dropped, Has no intention on continuing. The author got job]
God's Trial
God's Trials
God's Whims
God's wrath
God Vessel Online
God Yuje
Goes Unpunished
Going Against The Ordinary
Going Back Into A Distant Past
Goku And Saitama'S Ability With Demonic System In Different World
Golden Age
Golden Draconian
Golden Dragon's Ascension
Golden Fox with System
Golden Horde
Gold Over Gods
Golem
Golem core
Golem Power Armour
Gone Rogue, Arc I: A Fool'S Errand
Good Demon's War
Good Evil
Good Game
Good Morning World
Good or Bad. What's the difference?
GoO - Game of Origin
Gotta Gacha
Governor
Grahlgar the Ogre
Grand Adventure
Grand Arcanist: A Warcraft(Fan)Fiction
Grand Design
Grand Dream Online
Grand Fantasia Gates - He who Bled
Grand Magus
Grandma, let's form a party!
GrandMaster Dao
Grand Paladin
Grandpa Sweet Fist
Grandpa Universe In Multiverse
Grandsmith - Art of Forging
Grand Summoner
Grand Weaver: Renewal
Granny God-mode
Grantale Online
Graphomurk
Grasping Destiny (Temporary Hiatus)
Grasping for the Heavens
Gratuitous Item Crafting and Descriptions (and shoddy economics)
Graveborne
Gravecrawlers
Graven
Grave of Heroes
Grave Of The Goddess
Graves
Gravestone (Dropped)
Gravitas
Gravity
Gray Color HoC
Gray Hour: The Cursed Coin
Gray Mage: The Alchemist
Gray's Crucible
Gray Wolf.
Great Ascension to Godhood
Great Dragon Emperor
Greater Beyond
Greatest Gamer (Dropped)
Greatest God Li Ma
Greatest Superhero
Greatest Xianxia Book
Great Green Empire
Great interdimensional war
Great Martial King
Great Master of All
Great Red Revolution
Great sin
Great Tyrannical Deity
Great War of Cheater! Another World Strategic Warfare
Greed
Greenblood
Green Life
Green Mountain
Greenskin
Green Sky
Green Tea Sea
Green Tea Sea - A Grand Eye Tale
Greg Veder vs The World
Grey
Greyblood
Greyblood: Progenitor (A LitRPG Series)
Grey Eyes
Grey [HIATUS]
Greyskin
Grey Worlds
Grieyes Mages - Unknownly Superior Type Magician
Grimdark Ash: Twisted Fantasy
Grim Ether
Grimm
Grimmblood Volume 1.
Grimm Lord
Grimm, The Mythical Detective
Grimoire
Grimoire Bound
Grimoire Knights
Grimoire: Retake
Grimsly Elegy
Grimstone
Grimstone: A Dark Gamelit Western
G.R.I.M - This Grim Game Of Ours
G.R.I.M - This Grim Journey Of Ours
Grinding in Vast Martial World
Grinding Levels on Ossunica
Grinding to Become a Protagonist
Grin the Cheat
Gris Evighet
Grissla the Witch
Grocery Bag
Grow
Grow: A Scourge Wars Web Serial
Growing Puppets
Growing Strong
Growth
G.R.U.U.U.L
>Input Log Dates
Guanyin's Journey to the West
Guarded
Guardian
[Guardian]
Guardian Heroes
Guardian Of Nature
Guardian of the Oracle
Guardian of Wicked Sphere
Guardian Online
Guardian Reincarnation
Guardians Awakened
Guardians by Design - Land
Guardians of Midgard: The Legend Begins
Guardians Of The Helm
Guardians of Times to be
Guardians Will Fall, Heroes Will Rise
Guerra Moderna en un Mundo de Fantasía
Guess I'm a God now
Guess I'm a spy
Guidance
Guiding the Way
Guild App
Guildmaster
Guild of Thieves
Gunbreaker
Gun Elf
Gun Meister Online 2
Gun Meister Online [First Draft Complete]
Gunrunner
Gunslinger and Samurai
Gun X Princess
Gun x Waifu
Gura Gura no mi Cultivator
Gur-dun: Grey's Selection.
Gvera Cross Extras
Gwenn Mordredae
Gwyn's Pet Life
Habitat
HacKer;Deep Veiw
Hades XII
Häerandar the elf who is searching for a better life
Hail Storm
Hail The Emperor
Hail the King
Hai! My name is Satan!
Half a God
Half a Step Away from Love
Half-Blind Master(temporary title)
Half Breed Haven: A Hot Time At The Ol' Lucky Seven
Half Demon, half human.
Half Dragon
H A L F L I F E
Half Shaman
Half Step
Halfway to Home
Haliel's Adventure
Hall of the Immortals
Hallowdash
Hallowed
Halloweenish Project Time Lapse
Halloween Specials
Halo: Ascendance (Book One)
Halo:Nightstalker
Halo: Spartan-021
Halvard's Chronicle
Hammer of Order
Hanami
Hands Held in the Snow
Handsome Glock
Handyman
Hanging on Bones
Hanging out with the Mutants
Hangman
Hannah Forteza and her Forte Persona
HANNIBAL: Season 4 (Book Continuation)
Hans Pötterman and The Prisoner of Stalingrad
Haphazardous Debugging: Adaptation
Happiness!
Happiness System
Happy Dragon
Happy Ending
Happy Ever After
Happy Facility: Origins
Happy Fantasy World
Happy Happy Fun Time
Harbinger of the Damned
Hard Bargain
Hard Bargain - Discontinued
Hardcore Online
Hardcore OP-ness
Hardcore: Qi Worlds
Harder. Better. Faster. Stronger
Hardmode
Harem In Another World
Harem infinity
Harem King
Harem Reaper
Harems Are Evil!!-REVAMPED
Harems are only for wimpy guys?
Harem Trash: A litRPG Satire that No One Asked For
Harmony
Harmony: An Assassins Tale
Harrow
Harry Gamer (Revamp)
Harry Potter: and the Book Dweller
Harry Potter and the Dark Phoenix
Harry Potter and the Fourth Member
Harry Potter And The Immortal
Harry Potter and the Insert of the Self
Harry Potter - Book 1 - Arrival To The Harry Potter World As a Villain!
Harry Potter - Demons in the Sky
Harry Potters Second Chance
Harry's New Hobby
Harry-Stu Gamer by Zed019
Harukaze 春風
Harukaze 春風 V2
Harvester Wolf
Harvest Factory ~ a Farmer Life
Hateful Sin
Hater
Hatred: The Journey of the Madman [Old]
Hattie
Haunted
Haunting My Boyfriend
Haven
Havenbrook [Editing]
Haven Chronicles Book One - Eldritch Knight
Haven : Eldritch Knight
HavenFall (Thousand Lands)
Haven in a Dangerous World
Haven in a Dangerous World (Old)
Haven seeker: Rogue one
Haven: The Sky Scraper
Have Scythe, Will Travel
Having a Common Game Ability In Normal Life
Hayato the Chibi who became a Great Demon King
Hazard Frontier
Hazard Lands (Dropped)
Hazard Online
Hazardous Debugging: Reanimation
Headpats
Heads Will Roll
Heal Die Cry
Healer
Healer Prime
Healers Path
Healer to Blood Knight
HEAL: In Calamity, Terra & War
Healing Luck (Rota Rising Book 1)
Hearkened when he was Young (A Roman SI)
Heart Cores have hobbies (HIATUS)
Heartful
Hearth of the mountain
Heartless
Heart of a Dungeon
Heart of a Mer
Heart of a seagull
Heart Of A Servant
Heart of Borneo
Heart of Courage
Heart of Creation
Heart of Cultivation
Heart of fire
Heart of the Dungeon
Heart of the Forest (Hiatus)
Heart of The Home
Heart of the World
Heartscale
Hearts Of Rust {BL}
Heathens
Heather the Necromancer
Heaven and Hell
Heaven Chronicles: Raven rising (A LitRPG adventure)
Heaven Cry
Heaven Falls
Heavenly Blood Monarch
Heavenly Dao Of The Sword
Heavenly Domination
Heavenly Goddess
Heavenly Hollow Rhapsody
Heavenly Mage Shura
Heavenly Martial Harmony
Heavenly Paragon
Heavenly Rebirth - The Martial Hero's Journey
Heavenly Sovereign
Heavenly Will
Heavenly Yang Emperor
Heaven Made Travelar
Heavens and Flames
Heaven's App
Heaven's Awakening
Heavensborne: The Fall
Heaven's Brush
Heaven's Cry
Heaven's Daughter
Heaven Sealing Art
Heaven's Emergency Exit
Heaven's Fall
Heaven's Flute
Heaven's Grip : Orcs of Iaoue
Heaven's Oddity
Heaven's Will
Heaven Trial
Heaven Vs. Hell: Curse Of The Water Prophet
Heavenward on Golden Wings
Heavy Metal: A Cyberpunk Novelette
Hegemon
Heidi's Son
Heinous - The tale of an unusual necromancer
Heinous - The tale of an unusual necromancer (dropped)
Heir Apparent
Heir of the artificial Gamer system
Heir of the Divine Phoenix
Heirs of Creation- A Supernatural Fanfic
Heir to a Lost Sun
Heir to the Eternal Throne
Heir to the Throne
Helden's Keep
Held in the Quiet Night
Heleg en Eryn [ GERMAN / SINDARIN ]
Helena's Plane
Hellacious
Hellborne
Hellbound
Hell-Bound
Hellcrashers
Heller: New World
Hell Fighters
Hellhound
Hellish Ascendance
Hell Knight
Hell of the Dead
Hello..Main Character
Hell on Earth [You Decide What Happens]
Hello, You're Through To Hades, How Can I Help You Today?
Hell Pawn
Hell's Dungeon
Hell's Embrace
Hell's Finest
Hell's Insanity
Hells on Earth
Hells Pit
Helmer's Theory: A Butterfly Effects
Helm.Online
Help I'm a Pathfinder Commoner trapped in a Game world.
Hemophobia
Henchman
Heralding Fruits
Herald of the Night
Her Black Soul
HereAfter: Dragons Fall
HereAfter: Dragons Rising
Here I Stand (Stand User Si)
Here's Our Princess, Take Care Of Her! (And Don't Get Killed By The Dragon)
Here there be monsters
Here There Be Pirates: The Dragon and the Bear
Heretical dungeon
Heretic King
Heretic's Wrath
Heretic: Unbound
Here we go again
Her God of War
Her Highness Only Wants To Train
Her New World
Hero
Hero? Again? No Way
Hero aiming to be the next Demon Lord concurrent
Hero Chronicles:
Hero City
Hero Demon Synthesis
Heroes & Villains
Heroes and Ancients
Heroes and Villains
Heroes' Burden
Heroes Die First
Heroes & Harmony
Heroes of Erathia
Heroes of Errand
Heroes of Jorg
Heroes of Midlaris
Heroes of the Collapsing World
Heroes of war
Heroes Online : Against The Darkness
Heroes Online - Rosy Undead
Heroes Return
Heroes Wanted
Hero for hire
Hero:Generation
Hero Historia: Jericho Rising
Hero Hunter
Hero Hunter: A superhero litRPG
Hero Hustle
Heroic Chronicles Volume 2: Dawn of the New Beginning
Heroic Necromancer
Heroics of an Overlord
Hero? I'm assassin, but that's the same right?
Hero In A Monster Academy
Hero Is Now Villain
Hero Land
Hero? Nope I'm their child
Hero Of Demons (Hod)
Hero of Edea
Hero of Hsura
Hero of Naught (Original edition)
Hero, of the Locus (stillborn attempt, rewriting)
Hero or Demon Lord?
Hero or Fool
Hero or Monster
Hero or Villain?
Hero's Ballad
Hero's breaking
Hero's Call
Hero Scout
Hero's Gear Online
Heros Of 21st century !
Hero's Symphony
Hero's Tale: A Tragedy
Hero Status: Revoked
Hero Status: Revoked - Rewrite
Hero's Trouble; How did i end up as Hero?
Hero summoning ?? NO... it's are free soldier summoning !! (Discontinue)
Her Rage
Herrscher der Nacht
Her Secret
He's The One™
He Who Came From The Abyss
He Who Fights With Monsters
He Who Fought The Gods
He Who Have Sinned
He Whom is Abandoned
He Who Sits on the Throne
He Who Slays by Stevenoth: Discontinued
Hexes for Exes
Hey, Hero Killer!
[HIATUS]A Beautiful Twilight
[Hiatus] City Dungeon Abyss
[HIATUS] Dragon Scythe Online
(Hiatus) Dungeon Defender
[hiatus] Dungeon Run
[Hiatus] God of Plants
[Hiatus] In my second life, I will continue being a virgin.
[Hiatus] Player: Level 0
[HIATUS] Re:Turn, The Legend of the 4 Swords
Hidden
Hidden Abilities
Hidden Adversary
Hidden Darkness, a Star Wars story
Hidden Deity Of Destruction.
Hidden Forge: Lucem Ac Tenebras
Hidden Forge: Lucem Ac Tenebras (Rewrite in Progress)
Hidden Magics
Hidden Sins
Hidden Words
Hidden World
Hierarchy of the Ecumene
Hierohn
Highborn (The Stormforth Chronicles)
High-Class Mob
High Crew
Higher Beings
High-expectations and haughty thoughts
High God
High Lord Calamity
High School DEATH GAMES
High school life in a world where everyone has superpowers
Highschool Necromancer
High School of Magic and Weaponry
Highschool Sweethearts
High School with Humans
High Skies Piracy
Hightailing It
Highway Crooks
Hi,I'm Everything.
Hi, I'm Susan and I drive trucks for the Isekai Dao Displacement Department
Hiiro's adventure
Hikari Okami: Kitsune Series
Hilarity of a Game-Breaking Player [Hiatus]
Hill
Him and Her - An Odd(?) Story
Him? Her? I am Two, But Two am I [HIATUS/DROPPED]
Hinterland
Hiraeth: Awakening
Hiraeth, longing for a home that never was
Hiro's Journey
Hiro's Tale
His Android Wife
His Imperial Majesty, the Empress is a Venomous Fairy!
His Lordship
History of the Orcs According to, The Beginning: Breath Of War
History Repeats
His Whispers
Hit It Very Hard
Hit The Road, Jack!
Hive Consort
Hive Evolution
Hive Knight: Trinity of the Hive Book One[Completed]
Hive - Locked Up In Space
Hive Mind
Hivemind Overlord
Hive Prince: Trinity of the Hive Book Two[First Draft][Hiatus]
Hive Queen
Hoarfrost Wintertide
Hodgepodge
HofN original
Holders
Hold the line.
Hollow Core: School of Swords and Serpents (Book 1)
Hollowed Out
Hollow Heart Journal
Hollow Moon
Hollywood Delight
Holocaust Of Saturn
Holy Emperor Satan
Homecoming
Homecoming | A Chronicles of Ascension Story
Home Turf
Homeward Bound
Homicidal Aliens are Invading and All I Got is This Stat Menu
Homunculi
Homunculus Queen
Honestly I'm A Good Vampire
Honey Bun: Awakening
Honey, I'm home!
Honor of the battlefield
Hooked Up: A Magical Monk LitRPG Adventure
Hoopity Scoop: The Duck
Hope
Hope beyond the Horizon
HOPE Engine
Hope for Dawn
Hope in the Dead - Alone (For you Zombie Lovers)
Hope in the Dead - Survive Alone (Zombies)
Hope Springs Eternal
Horizon
Horizon Dawn
Horrific
Horror Bites
Horror from the Depths
Horsey Ashes
Host, At Least Let the Villains Act First!!
Host Me!
Hot Guy Cold Guy
Hot Springs Brigade!
Hound of Ériu
Hound of War
House Cazador: Kingdom of the Lion
House Denholm's Madman: Raising the Demoness in My Head
House Of Crossroads
House of Exiles
House of Matchsticks
House Of Omen: Indomitable Oathbreaker
House Of Omen: The Indomitable Smithersmith
House of the Dead
House of Wolves
How a Carpenter became the strongest melee fighter of the New World
How a lame loner's life is not like normal dudes
How Deep Can People Fall?
How Do Centaurs Wear Pants?
How Does One Become Strong?
How do you kidnap a whole school of kids to another world?!!
How Do You QA Test a Tsundere Android!?
How Everything Started
How I Became A God
How I became a monster
How I became op.
How I Destroyed The Main Questline At My New Job
How I escaped being a hero
How I got Possessed By A Barrel Of Porn
How I got Possessed By A Barrel Of Porn (Paused)
How infinite is infinity?
How I Rule The World
How Is It At Taldora
Howling
Howling Thunder
Howling Wind
How Much For Your Soul?
How Strange, I Seem To Be...
How The Weak Live
How to Avoid Death on a Daily Basis
How to be a Good Evil Overlord
How To Beat The Dungeon Boss : Reimagined
How to become a Demon Lord
How to become an evil overlord!
How to:Become an Evil Overlord
How to Become a Wizard
How To Be Human
How To Be Successful In Another World
How to Break an Evil Curse
How to Date an Android
How to Fake Your Own Death (Dropped)
How to get lost: a wanderers guide
How to get rich in ancient times
How to God 101
How To Go To Another World Manual
How to have fun in an apocalypse
How to Join a Cult
How to Kidnap your Princess
How to Kill an Isekai Protagonist
How To Kill Boredom (And The Gods)
HOW TO…(now complete with a 'Run Away From Your Death Flags' version!)
How to Perform Magic and Influence Fae
How to protect a hero
How to Run a Demon World: Lesson 101
How to Save a Star
How to Survive a Summoning 101
How To Survive Hell.... Kind Of
How To Tame Your Princess
How To Tidy Up Loose Ends
How To Wear A Crown
- Hp
HP The Birth Of Darkness
HRAIN: A StarFighter Story
HS Dungeon Crawl
Hui Lin: Speechlessly Cultivating
Human Altered
Human & [Inhuman]
Human Hunter
Human in a Demon's Hide
Humanity
Humanity's Hell
Humanity's last hope
Human Nature Never Change.
Human Outside, Demon Inside
Human Soul
Human Spawn
Human: Tower of Gates Book Two
Hundred Worlds
Hunger
Hunt and Heroes
Hunter - A LitRPG/Xianxia apocalypse novel
Hunter Markell
Hunters
Hunter's Academy "Aresia"
Hunter's Blind [Working Title]
Hunter's Bond
Hunter's Choice
Hunters Dream Online: Ascension
Hunter's Knife
Hunter's Odyssey
Hunters Of Reality
Hunters of the Night
Hunter : Surviving in the New World
Hunters World
Hunter Warrior In Wuxia World
Hunter x Hunter: Gon Freecs, The Multiverse Gamer.
Hunter X Hunter: Royalty and the World Beyond
Hunt for the ECSS Dark Phoenix
Hush - The Sin of Man
Husk
Hvn
Hybrids
Hybrid Summoner
Hydar Celestial Imperium
Hydra
Hymn of Ignis
Hymns of Stone
Hyperburst
Hyphen
Hy'Ruh-Ha
Hysteria (hiatus?)
I Accidentally Stole a God
I alone live it up
I alone live it up - HIATUS
I am.
I am a Bug
I am a Fish.
I am a genius so I don't need a strong cheat to survive
I Am A God Tree?!
I am a Guardian in another world!?
I Am A Hero: I Believe I Can Fly
I Am A Hero: In A Silent Way
I Am A Spaceship!
I am a tree
I Am Brand
I am but Divine
I Am Gamer
I Am Gamer Iv
I Am God!
I Am Going To Die (In This Game-Like Dimension)
I am Hulk!
I AM Human or Devil
I am infamous
I am in the Marvel Cinematic Universe?
I am Just a Farmer
I Am King: Book One (fourth draft)
I Am Legend
I Am: Mud Dragon
I am My Own Disciple
I am my own God
I am Not A Hero
I'am not a hero: My adventure in another world
I Am Nothing More Than A Mere God, Who Met a Human Woman While Searching For Peaceful Place
I am Ordinary
I Am Part Dragon (Part 1 Completed)
I Am Power
I am Prometheus
I am...*sigh* a speck of dust.
I Am Supreme (Reloaded)
I am the Chosen One
I am the firstborn of a new world...
I Am the "God of Death", Whatever That Means. (Original)
I Am the "God of Death", Whatever That Means. (Revised)
I am the king of all villainous villian
I Am the Last
I am the pirate gamer
I am the supreme evils daughter
I am the Villian
I Am Unstoppable
I am Urist
I am Urist (Book 1 Done)
I, a Water Snail, accompanying the Immortal Hero
I awoke as the hero of Oakvale
I Became A Building?
i became a Girl to win the Tournament
I Became a Member of my Friend's Yandere Harem?!
I Became A MOBA Character
I Became An Adventurer
I Became A Vampire In Another World
I Became A Virtuous Wife and Loving Mother in another Cultivation World
I Became my Granddaughter Familiar!? (ReWrite)
I Became Rat!
I became the strongest magical tome. But I am still a teacher! Book 1
I Became the Villainess, So I Decided to Ignore the Main Characters
I Bought Some Guy's Soul On eBay
I Came Back In Order To See You
I Came, I Ran
I can cheat? So let's have fun.
I Can Hear Your Thoughts, but it's not like I'm Telling You or Anything!
I Can Respawn In The Apocalypse
I can skip between worlds!!!
I can't activate my mana, so God gave me a system!
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic Love-Comedy Light Novel
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic-Love Comedy Light Novel
I can't believe my fiance chose me to be her cheat when she was summoned to another world
I can't die but I want to live in excitement...(Dropped)
Icebound Immortal
Ice Cubes
Ice Queen By Wi1dBi11
Ice Soulist
I Come From The Water
I could be in a coma
I Could Have Just Walked Away
Icy Vendetta
Idea Dump
Idealism
Ideascape
Ideascape: An Adventure LitRPG
Ideasthesia
I Decided To Become A Wandering God; A Record of Adventurous Newly Minted God
I Decided to Write a Story
Identity of the Abyss
Identity Undefined
I'd Give You Mine
I didn't actually want to change ♂♀
I Didn't Even Want to Live, but God Forced me to Reincarnate
I Didn't Expect to Wake Up as the Demon Lord
I Died
I Died And Got Reincarnated Into An Isekai World As An Elf With No Mana... But With An RPG System
I Died and Reincarnated as a Plant
I Died And Was Reincarnated As The Demon King's Daughter?!?!
I Died But I Reincarnated As Myself?
I died, so I'm trying again with all my stat points put into my Artistry stat!
Idle Dreamer: First World
Idle Immortal
Idmon the Skeleton
Idol By Laulau20
Idol's Road
I Don't Wanna Live My Second Life
I don't want to be a hero
I Don't Want to be a Hero! But I will fight to Protect my City! (Hiatus)(Might restart soon updated: 2-19-2016)
I Don't Want to be Evil, but You're Forcing me to be.
I don't want to be Famous!
I don't want to be the Hive Queen
I do whatever I please
I Enchanted The Whole Forest
If a Tree Cultivates in a forest and no one is around to stop it, does it make for a good story?
I Fell And Thus I Must Rise Again.
If i had emotions, would the world seem more beautiful?
If I Have To Be A Dungeon In Another World, I'll At Least Try To Be Fun
I Flew Into A Fantasy World And Got A Goddess To Use The Internet
If only...
If only common sense was a bit more common...
If We Cannot Grow Old Together
If You Give a Mouse a Dungeon
I Get a Second Chance and Accidentally Become a God
I Get A System, But I'm Still On Earth.
IGNARIS RAY by swey
Ignis
Ignite (The Fireborn Chronicles Book 1)
Ignius
I Got All The Spells But My Magic Stat Is One So I Became A Stage Magician But Found Out The Doom Spell Doesn't Care.
I Got Flown into a Fantasy World and Managed to Convince a Goddess to Let Me Keep a Laptop Connected to the Internet
I got nothing (I seriously don't know what to call this)
I Got Reincarnated as High Human with Creation Eye
I Got Reincarnated on Earth, Only to Get Summoned Back to My Old World
I got Summoned as a Saint with My Own Cheat System.
I Got Transported To Dota World with Just 2 shared Tanggos and qualing blade?
I Graduated to become an Ant Queen (Isekai)
I Guess I'm An Angel Now
I hate being wed in a fantasy world!
I Hate Systems
I Hate You Master
I have a Cat Problem (RWBY Comedy)
I have reach boundless infinity as a good for nothing. Now I want to restart in another world being the ultimate genius.
I have the Unique class of "Monster Factory"?[ DROPPED]
I Help My Friend Get Together with the Girl I Used to Like
i Hunt Mansters?
I Just Fell Asleep and Somehow I'm on The Battleship?
I just had a realisation recently that I am surrounded by bishies and...
I Just Want A Break From This Stupid Tower
I Just Wanted To Die But Instead I Became Immortal
I just wanted to fly
I Just Want To Eat 3 Meals a Day
I Just Want to Live a Peaceful Life!
I just want to play alone!
I Know I like Ships but Why did I reincarnate as a Aircraft Carrier?
I Live a Funny Life
I Lived as a Growing Great Sage with my Fairy Harem in the New World
I live in the dark world
I'll be happy as a monster
I'll do my best to (not)serve you!
Illicit
I'll Kill the Whole World for Them
I'll Pay2Win in Another World!
I'll try this cultivation thing
Illuminated Azure Dragon
Illusion
Illusion/Core
Illusory
I'll Wait For You At The Train Station
Ilm.Proxy Isekai
I Loved You
I love this world (Complete)
I'm a 70 years old mage not a little girl
I'm a Bat?
I'm a Bug in a Fantasy World
I'm a Cheater, So What?
I'M A Crazy Person Who Jumped In Front Of A Truck To Be Reincarnated Into Another World -On Purpose!
I Made One Mistake! Now I Have To Become the Demon Lord in Another World, But I'm Just a Frail Vampire Girl?!
Imaginary World (The half world chronicles)
Imagination Is Creation
Imaginator
Imagine Dragons
Imagining Online: The game
Imaginings
I'm a girl, but I like another girl?!
I'm a God?
~I'm a Good Boy~
I'm a Harpy Now I Guess
I'm a hero? Nope, familiar
I'm a Kitsune?
Im a Kobold, So what
I'm a Man!
I'm A Professional Gamer, So How Did I Become King?
I'm A Snaaake
I'm A Superhero
I'm a Vampire
I'm a Vampire [ Hiatus ]
I'm a wolf but I can level up?
I'm a wolf but I can level up? (Discontinued )
I May Or May Not Have Caused the Apocalypse...? Tee hee~
I'm a zombie
ImBalence
I'm basically a slave with a far too nice master
I'm clueless in another world.
Im Going To Another World Even Though Im Not Asian
I'm going to do it! I'm going to reincarnate into a fantasy world and live a great life!
I'm Gonna Be A Hero!
I'm Gonna Be a Wizard When I Grow up Again!
I'm Guilty, My Beauty
I might be Overpowered
I'm immortal but my girlfriend is OP
I'm in a different world....but I don't mind
Im in an otome game i know nothing about
I'Minas
I'm just a mortal
I'm just an 'Ordinary' Human (MCU fanfic)
I'm Just A Summoner
I'm Just the Guard!
Immense Space
Immersion
Immersion: Reboot
Immoral Cultivator Trump: The Alternative Facts
Immortal
Immortal Anarchy
Immortal Apocalypse Marketplace
Immortal Ascension Tower
Immortal Ascension Tower (OLD)
Immortal Chronicles: Quest For Truth
Immortal Cultivator System
Immortal Demigods
Immortal Demon
Immortal Dual Sword God
Immortal Dynasty (Rewrite)
Immortal God of the Blade
Immortal in a Mysterious World(Cancelled)
Immortal in Another World
Immortalis
Immortal Ki Technique
Immortal Mage
Immortal Martial God
Immortal Necromancer
Immortal on Earth
Immortal on Earth (Dropped, sorry)
Immortal Path
Immortal Rebirth
Immortal Rising
Immortal Shards(hiatus)
Immortal's Lament [Dropped]
Immortal's Life
Immortal's Musings: A Werewolf's Tale
Immortal Soul
Immortal Souls
Immortal Sovereign (Cancelled)
Immortals: The Curse of Samsara
Immortal sword
Immortal Swordslinger
Immortal Twain Dance
Immortal Tyrant in Another World
Immortal War
Immortal World
Immortel Evolver Dungeon
Immutable
I'm No Hero
I'm Not Going To Let You Capture Me!
I'm nothing special, so can i go back please ?
I'm Not the Demon Princess!
I'm Not The Dragon's Mom
I'm not the main character.
I'm Not The Protagonist?
I'm on TDY from Hell
Imoogi
I'm overpowered
Impera
Imperator of Beasts
Imperator Of Chronos
Impossible Devices
Impostor
Imppossible
Impractical Magic
I'm pretending to be a girl in a MMORPG
Improper force
IMProvised combat
Impulse
Impulsive - Descendants of the Gifted
Impulsive: Descendants of the Gifted
I'm Raising A Chuunibyou Dragon Girl?!
I'm reborn as Sakura... well f*ck my life!
I'm reincarnated as the last god?!
I'm Reincarnated in Another World but God is an Anime Addict?!?
I'm... Skeleton A?!
I'm (Sort of) an Expert on Ghosts
I'M Supposed To Be The Hero, So Why Am I A Skeleton!?
I'm Sure It'll be Fine! ...right?
I'm the bad guy!?
I'm the descendant of the Demon Lord!
I´m the Dog of a young Mageknight
I'm Too Tired of Being OP, So I've Decided to Lives Carefree Lives Instead[BL]
I Must Find Light, Or I Will F-ing Die!
Inada
In a different world with the Seven Deadly Sins system
In a diffirent world with One Piece system. cliche? No it's a cancer cliche
In A Distant Past
In a medieval world,Why i got a malus instead of a cheat?
In a modern world with a game system!!!
In a new world, so lets go it alone!
In another world as a homunculus.
In another world as a sim
In Another World With a God
In Another World with my Daughter
In Another World With My House
In A Parallel World With Random Skills, I Reluctantly Become A Mafia Boss?
Inara
In Association with Death
In a World of Magic
In A Wuxia World
In between lives
In Between Worlds
Incandescents
Incanto Anima
Incarnation
Incarnation : Another Dimension
Incarnation of Ice and Fire
Incarnation Of The One
Inception of Cultivation
Incomparable - (Unparalleled)
Incompatible Universe Merge
Incompetent Second Son
Incomplete
Incrementum
Incubus
Incursions
In dc universe with game system
Indefinite
(Indefinitely paused) The Stone-hearted Enchanter
Indigo
Indistinct Instinct
Indomitable Marvel
[Indonesian] Great world traveler
Industrialising Dungeon: The Crimson Forges
I Need Healing!
I need money to level up!
I Need Time
I need to repair the gods of a world?!
Inertia
Inexorable Chaos
Infarite
Infected Life {ON HOLD}
Infernal Bones: Book 2 in the Elemental Dungeon Series
Infernal Gems: Diamond
Inferno
Inferno of Ice
Infestation
Infested
Infigeas Online
Infinite Frontier
Infinite Hiatus
Infinite Hiatus (completed)
Infinite Horizon
Infinite Horizons
Infinite Legend
Infinite Levels
Infinite Lifetimes
Infinite Martial Way
Infinite: Monster
Infinite Possibility
Infinite Quest: The Crazy Ice Wizard
Infinite Realm: Monsters & Legends
Infinite Realms (Working title)
Infinite Swordsman and His Cafe
Infinite Thera
Infinite Trigger: Wandering Soul
Infinite Wishes
Infinity
Infinity Arcana
Infinity Hero
Infinity Loop
Infinity Online
Infinity Start
Infinity Summoner ~ Summoner Of All
Infinity Tomes - Legacy of the Ancients
Info on {The Sphere}
Infracto Animo
Ingame
Ingame 2 Homeland
In-game Item Storekeeper
Inglorious Bastard
In Heart and Mind
Inheritance
Inheritance Of A Hobo
Inheritor of the two dragons
Inheritors
Inheritors of Eschaton
In Highschool DxD With My Waifus
Inhuman
Initializing the Code System
Inked & Pierced (LGBT)
Ink Serpent
Ink Stained Eyes
In Life and In Death
In Love with Lightning
In Maple Halls
In Maple Halls, where Dwarves and Wizards Rest
In Memoriam
In My Name
In my Name as--
Inner Light
Innocence
Innocence: Exiled Prince
In order to create the Ultimate MC, I became Soldier A!?
In Our Image
In Our Last Moments
In Pursuit of Glory
Inquilbus
Inquisitor
Inquisitor [HIATUS]
Insane Familiars And How To Deal With Them in Game and Real Life
Insania Online
Insanity Online! The Forging of A TRUE NORD
Insanity Paradox
Insatiable Hunger
Insectasaur
Insect Dungeon Vs The World
Insect Dungeon vs The World. (On Hiatus!)
Insectum Chronica
Insert Coin To Continue
*Insert Title That'Ll Hook You In Cause I Don'T Know What Title To Think Of*
Inside Metsys
Inside my Mind
Insignia's Story
Insomnia's Embrace
Inspector of God
In Spite of it All
Instant Supreme God
Instinct
Instinct Unlimited
Integration
Integrity and Solace: Divine Intervention
Interactive Dungeon
Interactive Evolution
Interactive tribe
Inter Caelum et Terram
Intercessor
Interdimensional Garbage Merchant
Inter-dimensional House Travel
Interdimensional Traveler
Intergalactic Convicts
Interlude
Interstellar Warlock
Interstellar Warlock 1: Emancipation
Interstellar World Struggle TV
Intervention
Interverse
Interview With the Hattoris
Interweaved Destiny
Interworld
Interworld Network: The Time Master by Dmitry Bilik
In That Moment of Suffering
In the Aether
In the Another World with a Young Body
In The Beginning
In the City of Wisteria
In The Dragon Ball Universe With The Summoning System
In The Dragon Ball World with a System
In The End
In the End the Truth Remains
In the eyes of Infinity
In the Eyes of Others
In The Light Of Fire
In the MInd of an NPC
In the modern world with a game system!!! Reworking!!!
In the Name of God
In the Name of the Unholy Spirit
In the Naruto world (1)
In the Shadow of Heaven
In the shadows
In the Sorcerer's Service
In The Spiral: Connected Stories and Fragments from the Virtual Future
In The Tall Grass
In The Tyrant's Embrace
In this Dangerous World
In This World
Into a Fantasy
Into a Strange World
Into the Abyss
Into the Black
Into the Everwood
Into the Hulk
Into the Inferno
Into The Light
Into the Maelstrom
Into the one-piece world
Into the Portal: The Expedition in Centauri Planet
Into the rainforest
Into the Rift: Akali
Into the Secret (name still needed)
Into the Secret of Tirlus
Into the Sun
Into the Trenches
Into The Valley Of Gods
Into The Wasteland
Into the world of Hero Academy
Into What Is Impossible [Special Forces In Another World]
Intrepid
Intricate Soul
Intrinsics
Invader Zim >> Not Just a Defect <<
Invasion
Invasion by Fire and Thunder
Invent, Transform, Create and Destroy
Inverse Summoning
Inverted: A Dark Isekai Fantasy Novel
Inverted (Isekai)
Invictus
Invictus: Memoirs of an otherworlder on a mission
Invijible Panda
Invincible
Invincible Canadian Futa Goddess Cultivator
Invincible Canadian Hermaphrodite Goddess Cultivator
Invincible in other world
Invincible War God
Invincible wizard at Fairy Tail
InVirs
Invoker
Iona Online
I once was named Nguyen
I only know Curse Magic!
I only tried to change my childhood friend's gender!
I only want an ordinary life
I Only Wish I Had a Cliché Adventure
IQ 100+ Samoyed
Ira's Faithful
Iraslyn
I reached Godhood by mistake
I Reached Reincarnation Limbo Too Early
I Really Am An Internet Celebrity!
I reincarnated as a baby dragon king!
I Reincarnated as a God Working in a Shitty Sweepstakes Call Center
I Reincarnated as a Hero's Bad End
I reincarnated... As a human!
I Reincarnated as A Little Girl?!
I Reincarnated as an Alien Monster
I Reincarnated as an Elf in a Broken World.
I Reincarnated as a Panda
I Reincarnated As A System?!
I Reincarnated as the Queen, Now What?
I Reincarnated As The Universe
I Reincarnated in Another World as a Vampire
I Reincarnated in Another World as a Woman's .
I reincarnated into a bat (Indefinite hiatus)
I Reincarnated Into a Fictional Character
I reincarnated into a Game called Liberty of Immortals
I reluctantly became the dungeon master
Irminsul - [participant in the Royal Road Writathon challenge]
Irobu's Odyssey of Deceit
I.R.O.N
Iron Blood Overdrive (Hiatus)
Ironclad
Ironclad: Another world conquest with unbeatable technology
Iron Engine
Irrationality
Irregular
Irregular Awakening
Irregular Elementalist
Irregular Entity
Irregular (Rewritten)
Irregular's Rebellion
Irresponsible Former God of War Renox
Isekai Avenger
Isekai Delivery Service
Isekai Dudes On The Run
Isekai Gundam
Isekai Gundam (Dropped)
Isekai Gundam (Reboot)
Isekai - If I was Born in Another World
Isekai kami desu ka? -- (God of another world is it?)
Isekai Reporter
Isekai Speedrun
I.S.E.K.A.I. Squad
Isekai Strategy Game
Isekai Tales
Isekai trash story
Isekai Winner: Super Sweepstakes!
I Shall Be Hero No More!
I Shall Build an Army
I Shall Eat Everything
I shall seek revenge
I Shall Stand Supreme
I Shall Tame the World!
Ishbula-na' (I've joined the family of the lord of the 7th ring of the Abyss, help!)
Is Heaven Supposed To Be Like This?! -Mature
I should have been the Hero instead
Is it Possible to Kill a Hero?
Is it Really Ok for a Dungeon Master to Manage a Dungeon?
Is It Really That Hard To Become A God
Is it Reincarnation if I'm Still Dead?
Is It Wrong For A Spiritron Hacker To Pick Up Girls In A Dungeon?
Is It Wrong To Be A Mutant?
Is It Wrong to Try to Pick Up Girls When You're Disguising as a Girl?
Island
Island Of Gods
I Slipped into Another World and Became this Demonic Guy's Pet
Isolated Dungeon: Breaking The Chains Of Fate
Isolated Together
I somehow became a being that spams to survive unprecedented circumstances
I sort of brought Armageddon, but on the bright side, I can go to school!
Issekai Mockery
Is that a T-Rex outside my cave?
Is that a T-Rex outside my cave? (On Hiatus)
Is This Really Another World?
Is this really luck?
Is This The End?
I study magic, for destruction?
I Suck At Reincarnations
I Summoned You
I Survived and Came Back to Apocalyptic Earth
I Swear my Brother's the Protagonist of a BL Manga
Ithaca
Ithavoll Saga
I, the CEO have to Farm to Survive?
I, The Maou
I, the son of Bloody Mary, have become a king of 6 realms.
I think i lost my head
I Think My Familiar is a DemonLord
I Totally Don't Have Anger Problems!
I Tripped Over Satan
It's a Gamers world after all!
It's An Isekai Story, I Think?
It's a Reincarnation of the Reincarnator
It's a Reincarnation of the Reincarnator (Book I)
It's cause I'm a genius
It seems I reincarnated into that world, time to avoid the death flags!
It's not a game
It's not Paranoia if you're Right!; A Talltale of Nervous Wreck become a Duke in Other World
Its Not So Bad To Wake Up In A Goblin Dungeon
It's Only Another End of the World
It's raining goblins !? [Dropped]
It's the Healer's Life for Me
It's the Healslut's Life for Me
It That Laments
I turned into a little girl after I died?
It will end badly
I Unlive and Breath Death
I Value Your Clothes More Than Your Life
I've Been Summoned as a Hero ...I'm a God Though
Ivellee Ivelleh
I've reincarnated, but I'm a Girl! Wait, am I not even Human?
I've Reincarnated in another world as a cute fairy
Iverson's Pillar
I've Transmigrated... with a Broken System
I've waited my whole life for this THE Apocalypse /On hold/
Ivory Crystal
I wanna be a gamer!
I wanna be a hero! Beginning of the dark fantasy-
I Want a Dragon Waifu!
I Wanted to Play a Strategy Game, But I Became King Instead!
I Want It All - CHANGE!
I Want to Be an Adventurer to Defeat the Demon Lord but my Party Members Want to Live a Pampered Life!
I Want To Becoming A Great Summoner
I Want To Die, Let's Isekai!
I want to play this deadly game again.
I want to restart my world but still have my knowledge and a few cheats
I Want You to Remember Me
I Was a God Until I Got Summoned
I Was A Loner, But My Class Got Summoned To Another World And Now…
I Was a Teenage Necromancer
I was Bored So I Became The Antagonist In a VR Game
I Was Born For Glory
I was born the Unloved Twin
I was brought in another world as my catgirl avatar.
I Was Given A Second Chance, In a World of Fantasy?!
I was invited here
I Was Monster Once, Now I Am Human
I was Once the Demon King!
I Was Randomly Thrown Into A Game Like World By A Stray Astroid
I was Reborn as a Background Character
I was reborn as a Cursed Swordman ?! [HIATUS]
I was reborn as a hybrid dinosaur in Another World
I was reborn as a "Magical"Fairy which can't use magic!?
I was Reborn as the Villainess but I will become a Great Sage
I was reborn in another world with a maxed out speech skill
I Was Reborn Just To Be Killed?
I was reincarnated as a dungeon, that's good, but where are my cheats?!
I was reincarnated as a fox in a strange world
I was reincarnated as a goblins' slave, became the hero, and now have a harem. "I'm a girl bye the way!"
I was reincarnated as a Magic Academy!
I was reincarnated as a monster flower
I Was Reincarnated as a Prince, but my Kingdom is in Danger from Enemies!
I was Reincarnated as a Puddle of Water
I was Reincarnated as Bai
I Was Reincarnated as Someone's Mana??
I was reincarnated into a fantasy world as a woman?!
I Was Reincarnated Into A Harem Game As A Villain, Please Stay Away I'm Gay! V1
I Was Reincarnated Into Another World As A Fish
I was reincarnated into my own unfinished Isekai Light Novel and became apart of the hero's harem.
I was reincarnated on the One piece World
I was Scum, now I am even more than Scum
I was summoned as a Dragon?!
I was Summoned as a Hero, but I Became the Demon Lord Instead
I was summoned in another world
I was summoned to another world, but i'm a dog!
I was summoned to another world without any cheats so I became a villager
I Was Summoned To Have Tea With The Demon Lord, But Now That I'm Stuck In This Other World, I Guess I'll Defeat Him
I was the pet rabbit of a young druid girl in my next life
I Was Transported To A Desert Wasteland
~I was Transported to another world and became overpowered thanks to my cheat skill~
I who have Fallen
I will absolutely cultivate
I Will Always Be With You
I Will Be The Harem King!
I Will Burn Up My Kingdom And Disappear
I will create a kemono paradise!
I will Kill the Hero! With Fluff!
I Will Pave My Path With Blood
I Woke Up As A Girl?!
I won't destroy the world!
I Won't Kill Myself for the Second Time
Izar
Izumi Hayato with System
Jack
Jack 21
Jack at World of Syntaria
Jack Mercury: Battle Academy
Jack-of-All-Mages
Jack of the Devil's death forged body
Jack's Adventure
Jack's Journey
Jack, The Inter-Galactic Wizard
Jacob WillBreaker
Jade Fire
Jade Fire (Hiatus)
Jade Fire (Wuxia)
Jade General
Jade Immortal
Jadepunk
Jager: The death Angel
Jake and the Dynamo
James Foremans Star Jump
Jane Doe Chronicles - The Case of the missing Imaginary Friend
January City (Project Lunation Book 2)
Jasmine
Jaune, The Strong
Jayke Cipher
Jayson Agonistes: Breaking Hell !
Jellyfish
Jeweler
Jezoi
Jigoku 101 no dasshutsu hōhō.(How to escape hell 101)
Jiharu: A Story of The Hunt
Jimoel the Great and Powerful
Jim's World
Jin
Jinsei no Hineri
Jinsei no Hogo
Jintetsu
Jin The Talentless
Jirandai
J`nk: Refuse Refuge
Job Arseoth - A Choose Your own Adventure
Job Arseoth - A CYoA Adventure
Job Change
Jobless Knight
Jobs for an Occult Handyman
Joe & Jess: Life inside a PC Game
Joe in medieval fantasy world
Joe– the chimpanzee cultivator
Joh-El, a Kryptonian in the Marvel World.
John
John Doe: A Nobody in Space.
Johnny's Bizarre Fidget Spinner
John Smith
John the Average Knight: Marvellously Mundane
Joie de Vivre
Jojo's Bizarre Adventure: Kars' comeback
JoJo's Bizarre Adventure: Run the Jewels
Joker's Potpourri
Joker's way of life
Jokes On You
Jolt
Jonah Now Jasper
Jona R. Torres and The Sea Empire of Navarren
Jormugandr's calamity
Jormungandr's calamity
Joruney To The Starry Sky
Jotuun
Journal of a Falcon
Journal of poetry
Journals of Cultivation
Journal Teleport Science Something
Journey
Journey for Destiny: One Piece
Journey In A New World
Journeying Home
Journey into My New Life
Journeyman
Journey of 365 Days
Journey of 365 Days (((Kind of Completed)))
Journey Of A Creator
Journey of a God [LitRPG]
Journey Of A Hawk
Journey of a Mage
Journey of a Skeleton (undergoing rewrite on different account)
Journey Of A Stoner
Journey Of Destruction
Journey of Key (Updated)
Journey of my Core
Journey of Robotics
Journey of the Black Rose
Journey of the cheerful assasin
Journey of the New World
Journey of the Time Mage
Journey Of The Unrivalled Mage
Journey: Rayder White.
Journeys in the Fairworld: The Brigand of Potham (Complete)
Journeys in the Fairworld: The Gatekeeper
Journey Through the Realms
Journey Through the Underdark - Eric EarthScorn Book 1
Journey through the Worlds
Journey to Boundless Infinity
Journey to Elvander
Journey to Power
Journey to Raise a Dodge-Debuff Scarecrow
Journey to the Underdark - Eric EarthScorn Book 1
Journey West 5000
Jovan's Gaze
Joyde's Yellow Book - Volume 2
Judas Valiant: Chorus of the Machine Giants
Judging The Creation
Jumper
Jumpspark
June
Junkland
Junkyard Magician
Jupiter's Rising
Jurassic Island
Juryokine
Juryokine: Exile of Heroes
Just a Bystander
Just a Guy in Space
Just Another Dungeon
Just Another Isekai Story
Just another random summoning story
Just another RPG story
Just An Outlier
Just a passing goddess, don't mind me.
Just a Pawn
Just a random guy surviving Apocalypse litRPG
Just a random Zodiac Book in the Internet
Just a Rock[DROPPED]
Just a Simple Guy
Just A Simple Heist
Just a Teacher
Just A VRMMO Story
Just a zombie trying to survive
Just Bear it
Just Call me Yumi
Just Don't Shoot the Quartermaster
Just For Fun
Justice in the One Piece World
Just Luck
Just one more level
Just Useless Ideas for a Novel
Just your typical isekai story, or is it?
Just your usual summoning story
Juvena
Juvenile Gladiators
Kael Cor:A Vampire's Awakening
Kael - Rise of the Blood Mage
Kaels Adventure
Kage in another world
Kage no Kami
Kage System
Kaiba's Prostitute
Kail's Life of Adventure [dropped]
Kain's Adventures
Kain, the Caveman
Kairos
Kairos & the Snowdrifts
Kairos & the Snowdrifts (Edited)
Kaiser de Jinrui
Kaiser Jager The Mutagen Hunter
Kalar's continent
Kaleidoscope
Kaleidoscope End
Kalestra's Chosen **On Hiatus**
Kalethia
Kali Yuga
Kallix Rane
Kalos
Kammi Kettu
Kana Adventure
Kana & Wing: Adventure Time on RoyalRoad
Kana death god
Kanai's Alchemical Rock
[Kancolle] Diary of an Admiral
Kanojo no Jin
Kano's Necromantic Comedy
Karacatoa - Descent into Madness
Karl Became an Axolotl and now he's in a Cave
Karma
Karma and Reincarnation
Karma Online: Awakening
Karma's curse; the demon lord of wrath
Karma - The Game
Karmic System
Karn
Katalepsis
Katra
Kaylee's Journey
Kazama wa Onnaline
Kazan - The Hero No One Wanted
Kaz the infinite one
Keeper
Keeper of Steeds
Keepers of Truth
Keeper's World
Keeping The Balance
Keep it a Secret
Keflar - A Tale of an Unusual
Kenosis of the Light Bearer
Keter
Kether(Discontinued)
Keybash! GAME JAM!
Keys of the Endpoint
Key To Abusing The System
Kibo: The New Age of Cornith
Kichiro's Rampage
Kill 10 Rats
Kill Anna!
KillDozer
Killed, Blessed, Reborn
Killed by a Japanese girl who fell crotch first on my face
Killing Amount
Killing Game
Killing X Intent
KillStreak
Kill the Joker: Survival Game
Kill Thy Gods!
Kinda Dead: The Infernal Escapee
Kinda Real Online
Kindling Stars
Kindling Stars [Hiatus]
Kindred
Kindred Spirits
Kind's Kiss
Kinetics
King
King Above All Others
Kingdom
Kingdom Come
Kingdom Come: Archemi Online Chronicles Vol.3
Kingdom Creation System
Kingdom of Bees
Kingdom of death
Kingdom Of Demons
Kingdom of Heartedvast
Kingdom of Mallic
Kingdom of Monsters: La Guardia
Kingdom of Stars
Kingdom of the Dead
Kingdom of The GhostShepard
Kingdom of the void
Kingdom of Tyr (Original)
Kingdom Quest
KINGDOM RISE, CASTING CROWNS: Your Way Called Peace
Kingdom Saga
Kingdom Shattered
Kingdoms of Blood, Magic, and Apocalipse
Kingdoms Online
Kingdoms: The Game of Feuds and Feudalism
King Elementalist
King given from God
King - Hiatus
Kingmaker
King Of All Heavens
King of Another World
King Of Ant
King of Glass
King of Hell
King of HOLLYWOOD (Revised)
King of Kings
King of Nobody
King of Ohst
King of Rogaria
King Of Solace
King Of The Broken World
King of the Djinn Kingdom
King of the Fall: Origins
King Of The Farm
King of the Mountain
King of the Mountain, Again
King of the Multiverse
King's Anarchy
Kings Game : The Origin Of A Monster
Kings Game : The Origin Of A Monster (Rewrite)
King's Game : Zixx (The Monster)
Kings: Immortals Amongst Us
King Slime:From an Experiment to A Ruler, Backstory of a Boss
Kings Rising
Kings Rite
Kings: The Fall
King System
Kingun
Kira's second life
Kirby System
Kiri to Shinkirō | Mist and Mirage
Kisama No Ketsugo
Kismet Online: Root Alpha
Kismet - Volume 1 - A Song Written from Ash
Kitsune in Rockford
Kiturasha God
K.I.X
Kiyu's Box
Klaxon Overdrive Supernova
Klaxon Overdrive Superrnova
Knight & Condemned (Completed)
Knight and Deserter
Knight City Nights
Knight & Condemned
Knighted
Knight Endeavor: The Crimson war
Knight Hunter
Knight of the Rising Sun
Knight of the Rising Sun Volume 1: The boy with the katana
Knight's Crusade: Regulus War
Knights of the New Queen: Protector
Knights under a Green Sky.
Knight X Magic
Knowledge and Power
Known Danger System 42
Know Thy Enemy
Koala Online
Kobold
Kobold Whisperer
K.O.D. by Lirg123
Koins for Karon
KOJI FIGHTS THE WORLD! (The Bonder Legacy Book One)
Kool Kobold
K. O. Romance [ノ ッ ク ア ウ ト ロ マ ン ス]
Korrupted Angels
Kosmos
Kova + Rey
Kripp's Fate
Kudo's Magic Touch
Kueng Ning
Kunoichi Online
Kuromori-san's Table Tutorial!
Kuro's Days
Kurouzu 「クローズ」
KurtzPel:
Kusan The Death Lord
Kyle
Kyrio's Monster House
L
Labyrinthia's Maze
Labyrinthium
Labyrinth of Anchored Moments
Labyrinth of Gods
Labyrinth of Light: Stormbringer
Labyrinth Of Puppets
Lackluster Adventure of a Side Character
Lacraea: The Slow Journey To riches
Lads of the Triangles
Lady Bunny
La Familia mas poderosa del mundo de Harry Potter
Lagoon
Lainzax
Lair
Laksil
Lamb of Misfortune
Lambs and Wolves
Lament of The Demiurge
Lament of the Determined
Lament of the Fallen
Lamplight
Lamp of Gods- Tales of an Immortal
Lancelot Deep Impact
Lancelot Dungeon
Lances & Daggers
Lances and Daggers
Lances & Daggers
LandFall's legacy
Landfill Life
Land of Astria
Land of Athlora
Land of Chi: The Legacy Trial
Land Of Dragons
Land of Ilragorn
Land of Irith
Land Of Zhelerez
Land Warrior: Greyhounds
La puerta de Maltras
La Puerta de Maltras eng.
Laria - A LitRPG
Laruse
Larystaro
Lasershark of The Laserocean
Last Born of Kiedarth
Last Dance
Last Dream
Last Feast
Last flames of the Old World.
Last Flight of the Raven
Last Game
Last Goodbye
Last Grace: The Apex of Another World
Last Grace: To the Apex of Another World
Last Hope
Last Howl
Last of the 300
Last of the Mage-Kings
Last Ramas
Last Shadows of a Booming Sky
Last Son
Last Stand
Last Voice in the Darkness Series, Book 1 - Survivor
Last wish from Dead past ( on work title)
Late Night at Lund's
Late to the game
Lawless
Lawless Ink
Law of Creation
Law of Divine Gates
Law of Incongruity
Law of Shadows
Law of the Forest
Law of the Jungle
Laws of Defiance
Laws of Fate
Laws Raine
Layers of Hell
Lazarus: Jove's Tale
Lazy Ash
Lazy Cat
Lazy Cultivation
Lazy Detective
Lazy Dragon Queen: Gaming in an Illogical World
Lazy Man's End of the World
Ldk
League of Meruem
League Of The Void
Leagues Away From The Sun's Light
Leah, Reincarnated As a Dungeon Core!
Learning to be a Bad Guy
Learn to Evolve
Leaving Earth
Left In Sorrow
Left Over Necromancer
Left the World as Villager A. Came Back a Mecha Pilot.
Legacy
Legacy: God's Inheritance
Legacy: Lord Alba
Legacy of Darkness: Book 1 - Darkness Ascendant
Legacy of Darkness: Book 1 - Darkness Rising
Legacy of Ennea
Legacy of Kail
Legacy of Power
Legacy of Terra: Forgotten
Legacy of the Ancient
Legacy Of The Blade
Legacy of the Damned
Legacy of the Demon Lord
Legacy of the forgotten
Legacy Of The Prototypes
Legacy of the Resourceful Hero
Legacy of the spirit king, Spirit Dungeon God edition (Currently being rewritten / revamped)
Legacy of U.L.T.R.A
Legacy of U.L.T.R.A (dropped)
Legacy of U.L.T.R.A (hiatus)
Legacy Of Weapons
Legacy Online
Legacy (vrmmo game)
Legend
Legendarium
Legendarium Props
Legendary
Legendary Continent
Legendary Dungeon Seed
Legendary Elemental Knight
Legendary Exile
Legendary Puppeteer Master
Legendary Reincarnator
Legendary System
Legendary Twilight Farmer
Legendary Wife : Overpowered Songstress book 1
Legend Land: Tale of the Nameless God
Legend of Amnesiac Archer
Legend of Chase Marcus
Legend of Eterna
Legend of I, Reaos Alzerin
Legend Of Kaiser
Legend of Legendary Summons!
Legend of Lunos [Dropped]
Legend of Magus Academus 1: The Pillars of Unity
Legend of Mammon
Legend of Rall Gregory
Legend Of The Blacksmith King {Hiatus}
Legend of the Conqueror by CyberBeast
Legend of the Crystal Borne: Wielders of Lightning
Legend of the Devourer of Kings
Legend of the Empyrean Blacksmith
Legend of the Evil Hero
Legend of the Five Knights 1- Rise of A Guardian Angel
Legend of the Five Knights 2- The Shadow of Justice
Legend of the Guild: Point Blank
Legend of the Gunslinger Mage
Legend of the Heavenly Monarch System
Legend of the immortal robot
Legend of the Infinity Blades
Legend of the Lost Star
Legend of the Lost Star [Book 3: The Last and the Lost]
Legend of the Lost Star [Book 4: The Unravelling World]
Legend of The Monster Slayer
Legend of the Nameless Hero
Legend of the Perfect Emperor
Legend of the Phantom Hero
Legend of the Sage by Daedalus
Legend of the Seven
Legend of the Sword God
Legend of the Undead Sovereign
Legend of the Void
Legend of the Void Walker
Legend of the wasteland
Legend of Truck-san
Legends
Legends of Balance: Alaiah
Legends of Bitworld: A Misnomer's Tale
Legends of Dorthar: Kato's Tale
Legends of Etheria
Legends of Gods. Tale of Vjaira.
Legends of Lost Fallow: Age of Heroes
Legends of Pandorus I: Song of A Crimson Angel
Legends of Regalia book 1: Tyranny and Villainy
Legends of Tarthirious, A LitRPG, Book One of Kylia's Story
Legends of Tarthirious: Book Five of Kylia's Story
Legends of the 21st Century (Complete)
Legends of the 21st Century (dropped)
Legends of The Great Savanna - Complete Book 1, Ongoing Book 2
Legends of the Shadow Immortal
Legends of The War God
Legends of the Wesh: Lochley
Legends of The Worlds Gate
Legends Of Valkyries:Endless war on Middle Earth
Legends of Zyantra: Immortals
Legends Online
Legend Tales: Fallen Hero
Legend: The Rise Of The Black Phoenix
Legion
Legionary (dropped)
Legion, God of Monsters
Legionnaire
Lein Saviik
Lemme Smash! (Hiatus)
Lemondream
L'Enfer et le Lapin
LEo
Leonel's Workshop
Leonora
Les Cents Royaumes d'Aldire [French]
Les Kerns de l'Oubli - tome 1 : L'Exil [FR]
Lesser Throne of Seventh Heaven
Leticia
Let's Be Gods!
Let's Define Evil
Let's Explore The New World!
Let's Form a Party to Kill God
Let's Go Anywhere: The Journal of two Idiots
Let's Invade A Fantasy World!
Let's play a game
Let's Shine
Letter B Above Hell
Letters from a Dying World
Letters From Beyond
Letters: Naruto's Rebirth and Redemption
Let the games of survival begin!
•Let the Hate Consume You•
Let the hunt begin!
Let there be fire
Let The World Burn in Ruins
Letting Go...
Level Down
Leveling Immortal
Leveling up !
Leveling Up Is Better Than Reality
Level One Chef
Level Up
Level Up!
Level Up Lord
Level up or Die: Masochist
Level: Zero
Levia Codex
Levis Magus
Lewd Slime Surpassing The Heavens With Yandere Waifu
Lewis
Lexson of Aerolite
Ley World-The Game
LFSA - Starting from the summoning
Lia and Lara will seek the One Piece
Liar Liar
Liars Called
Liberi Fatali
Liberty in the Overlord Universe
Liberum Mundi
Library Magic
Library of Knowledge - A tale across worlds
Lichen Leech
Lich in Hero's Realm
Lich. The Depressed Necromancer
Lied
Life and assumptions of Dread The Caveman
Life As A Dungeon Core
Life as a mercenary (Inactive)
Life As a Servant
Life as a solo gamer
L.I.F.E. Begins
L.I.F.E. Begins (Book 1 - Complete)
Life - Break
Life Changing Status Screen
LifeCraft
Life, Death and Other Troubles
Life Hunter
Life in a changed world
Life in a Fantasy World
Life In A Galaxy Far, Far Away
Life in another world
Life in another world (On hold)
Life in Newerth
Life in New World (LNW)
Life In Purgatory
Life Insignia - A Lit!TacticsRPG.
Life in Thar'al
Life in the naruto world.
Life in the New World
Life in the North - An Apocalyptic LitRPG
Life is Boring.
Life Is But A Game
Life is Feudal
Life Is Just A Game
Life is not a game: Ice
Life is too short, let's murder to make it longer!
Life is Wilde
Life Leak
Life Magic, An Elemental Fantasy
Life Merchant
Life: New Game +
Life of a gloomy boy
Life of a Hairpin
Life of a Immortal
Life of an Irregular
Life of an Undead
Life of an Unusual Troll
Life of David
Life of Evil
Life of Numbers
Life of the dark god
Life Of The Vampire Girl
Life Of The Vampire Girl - [Dead]
Life on Jupiter Station
Life Reset
Life Restart: Team Deathmatch in Another World
LIFE - Root
LIfe's a game
Life Sentence
Life's Exodus
Life Spent
Lifestones of Lebreima
L.I.F.E. Stories
Life Sucks So Deal With It (LSSDI)
Life Symphony
Life, the struggle for existence
Life::Uploaded
Lifeward
Life With A Blue Screen
Light is suppose to be weak
Lightning Does Strike Twice
Lightning Heroic
Lightning Soul Emperor
Lightning Watt
Light of Gemini
Light of Shadows (Dropped...)
Light of the Heavens
Light of the Moon
Light Of The Nine
Light Rays
Li'Kyes the Scaled Hero [HIATUS]
Lilac Moon
Lilies Over Roses, Spring Over Autumn
Lilith
Lilith, the Demon
Lil ko's heart
Lily Bouquet - A Girls Love Anthology
Lily Ex Machina [COMPLETED]
Limerence Somnium
Liminal Radiance
Liminal Radiance: Path Of Old Dreams
Limit Break
Limited Fears
Limited to Pampering in Marriage: Report to Captain, I'm Pregnant.
Limiter Off
Limitless
Limitless Adaptation
Limitless Lands
Limitless Lands Book 2, Conquest
Limitless Paradox System
Limits
Lineage I
Lings
Link
Linked
Lionheart - Chronicles of Two Worlds
Lion's Heart
Liquid Magics
Lirgaid's Adventure
Lissana
LITRPG (Book II) - Mecc 12 : Cannon Fodder (Unedited)
LitRPG: Grand Age - Lord Of Bloodlines
Litrpg What A Fun Way For The World To End
Little Baron & Big General
Little Devil
Little Fish Dreameths of the Sky
Little Fox
Little Fox Soaring to Heaven
Little karma game
Little Legs
Little master in a new world
Little presence and almost no shadow
Little Red: A fairy tale RPG
Little Thief Not anymore ~
Live by the Sword
Live Life Homunclus
Liveship
Lives Of The Immortals - Rise Of The Strongest Magician
Live So That You May Live
Living a Long Life as a Legend
Living a Regular Life with a Game System
Living as I please, As a loli Demon King
Living Free
Living Happily in Another World
Living in a Fantasy Sucks
Living In A Fantasy World
Living in a Game-Like World, is a Skill (Random Schedule)
Living in another world in peace and harmony i think!!!??
Living in an Urban Fantasy
Living in His Dreams
Living in His Dreams (Ongoing)
Living in my Own World!
Living in This World
Living Legend
Living Life as a Demon
Living Life As A Game: Through And Through
Living Life as a Plant in a Magical World, Quite Strange Right?
Living Steel
Living the Fantasy
Living Weapons
Living With Job System On Earth
Living With Magic
Lizardventures
LMF = Legendary Midnight Farmer
Loaded Dice
Loading...
Load State 01
Load Them Up!
Local Heroes
Locking Horns, Breaking Teeth.
Locking Horns, Breaking Teeth. [Minotaur Paladin Rewrite.]
Logical Labyrinth
Log of a Slime Evolutionist
Lohikarmen: A tale of humans and dragons
Loiterous
Loki's Daughter, Tales of the Opal Dungeon
Loli Saga
Lone Alpha.
Loneliness
Lonely Light (Complete)
Loner Boy
Loners' Aimeless Journey
Lone's Story Playground!
Lone: The Wanderer
Lone: The Wanderer [Rewrite]
Lone Wolf
Long Experience
Long Island
Long Lost Traveler
Long Shadow
Longshot
Longshots
Long War
Looking Down From Olympus
Looking For Something Appropriate
Looking for the Sun
Looking through the window
Looks like I am a Cat-kin now?
Looks like I transmigrated into the body of a 'Saint'. What? I can do more!?
Loop - A time story
Loop of the destiny
Loose End
Loose Screws
Loot Mule
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!
Lord Azul
Lord Fear
Lord Grayson
Lord of all vamps
Lord of Dawn
Lord of Flukes
Lord of Glory
Lord Of Goblins
Lord Of Horrors
Lord Of Horrors [DISCONTINUED]
Lord of lust
Lord of Monster
Lord of Nightmares (dropped)
Lord of the Apocalypse
Lord of the Branchless Path
Lord Of The Flora
Lord of The Heavenly Villa
Lord of the Night
Lord of the Seas
Lord of the skies
Lord Of The Spells
Lord of the Supernatural
Lord of the Void
Lord of the White Flame
Lord of Undeath
Lord of War: Pandæmonium
Lordrian who was.
Lord Shadow
Lord Universe Creator
Lore and Legend - The Werewolf
Lore Unleashed
Lorian Ellins
Lorian Ellins [Dropped]
Loser of Tarinath
Losian
Losing My Pride in that Vixen's World
Lost
-Lost-
Lost Archive
Lost Between the End and Now
Lost Blood
Lost Call
Lost Chapters of Eschatology: Vanguard
Lost Child
Lost Concord
Lost Crimson (book 1)
Lost Eden
Lost Emperor
Lost Girl
Lost Heroes: Atalanta
Lost Identity
Lost in Acleirea
Lost in a Dream
Lost in a Magical World
Lost in an RPG World
Lost In A Universal Sandbox.
Lost in Love
Lost In Space
Lost in the New World
Lost in the Past
Lost in the Wind
Lost in Time
Lost Leaves
Lost Lume: Project Rosaria
Lost Magic
Lost One
Lost on the other Side
Lost Origins: Ressurection
Lost Realm
Lost Shield
Lost Soul
Lost Soul Found Soul
Lost souls
Lost souls ( rewrite in progress.)
Lost Star
Lost Tomb of the Necromancer
Lost to the Mist
Lost Within Another World
Love Against the Karaoke Heavens
Love & Witch Craft (A Web Light Novel )
Love at First Theft
Love Crafted
Love.exe
Love Gone Wrong
Lovely kNight: Our kiss will save the world?!
Love Of Baybur [Participant in the Royal Road Writathon challenge]
Love Paradox
Lover's Life Line system
Love's Vicissitudes: A Pursuit of Beloved Wife
Love,War and Astrovia
Love with Danger in the Purple: Being Beloved by the Hardhearted Avenger
Loving Violet
Low effort generic wish fulfillment story
<< Lucid Dream >>
Lucas Everton
Lucian
Lucid
Lucid Dream
Lucid dreamer
Lucid World
Lucifer Dark the summoned fallen angel
Lucinda the Shifter
Luck Based?
Luckiest person in the world!
Luck Lockyer
Lucks Requiem
Lucky Dragon
Lucky Me!
Lucky Number Seven
Lucky Riot and the Mystic Dragon
Lucy Wickshire
Lucy Wickshire (warning: sexual content)
Lume
Lumiere: The Astral Wanderer
Luminate Online
Luna
Luna Daemonium
Lunar Eclipse
Lunar One
Luna: the Lunatic
Lupa's Quest:
Lust, like Vengeance, Demands Red
Lustrous Odyssey
Lust uncontrolled!
Lust uncontrolled! (Complete)
Luxury Cafe Owner
Lv1 Creature
Lyaga
Lyca: Rise of Asura
Lyle
Lyre: The Beginning
Lys
Mabbo's Obscure Short Stories
Macabre Mim
Mace of Domination
Mad House
Madi
Madly insane
Madly insane (dropped)
MAD MAGUS: A Tale of Almost Gods
Madness
Madness with a touch of sanity
Mad Sci Soc
MAD Wendigo
Maelstrom book 1 - A new beginning
Maelstrom Interlude - Defiance
Maelstrom - New Generation
Maestro Therapy
Mafia God!
Magefall
Mage Hunter
Magenta
MAGES: Ascension : Hiatuss Infinitetum
Mage Slayer
Mage without mana
Mage x Magician
Magi
Magic Academy ( hiatus)
Magical Adventure
[ Magical Amputee]
Magical Beasts
Magical Cosmic
Magical Fraulein and the World Euphonics
Magical Girl Gang Wars
Magical Girl Selector
Magical Paradise
Magical Popcorn
Magical Puzzle
Magical Taboo
Magical Tournament: Rise Of The Black Swan
Magic & Love
Magic and Mayhem
Magic and Mercenaries. What can go wrong?
Magic and time
Magica Storia
Magicat
Magic Barbarian
Magic Beast Eaters
Magicbound to a Snake Girl
Magic Conquest / A Way to Magical World? or Not
Magic Continent Zero
Magic Fighter
Magic God of DxD
Magic Gunslinger
Magician Endeavour
Magician's Code
Magician's Stigmata
Magic is Magic
Magic is Overrated
Magick Alive
Magic Knight Legends: The Phoenix Empire Pilgrimage
Magick Online
Magic, Monsters and Medieval Mayhem.
Magic, Monsters, And Other Things
Magic Monsters Money
Magic Not included
Magic of love (a GB yuri yandere story)
Magic Online
Magic-Smithing
Magic Squared
Magic Swordsman, King Slayer.
Magic System: Becoming a Deity
Magic Within: A Thiefs End
Magic With You (BL)
Magic;World
Magic Zero
Magidrasa
Magikind
Magikind [Original]
Magikind [Rewrite]
Magik Obelisk Rewrite
Magik Online
Magitech Awakenings
Magitist
Magium
Magma Core ( A Mage's Journey)
Magnum Opus
Magnus
Magnus of Theta
Magune: Let The Magnet Rise
Magus Gravity
Magus of Soul
Magus Sunt Inferus
Mahouka x RoyalRoad By lolandylol
Mahou Shoujo Hologram Universe - A Grand Eye Tale
Mahou Shoujo Reincarnation
Maiden's Moon
Mai Girl
Main Character in Author's World
Majai
Majeera Chronicles
Majority Rule
Major Naird's Fantasy
Make God Bleed!
Make Me the Protagonist, Please!
Make Me Wanna Die by Rock
Make No Mistakes
Maker Of A Universe
Make Your Mark and Other Stories
Making a difference
Making a Mark In The World
Making an Island
Making an Island (ReWrite)
Making magic, Forging fame.
Making my own Harem (dropped)
Making the best of a Betrayal
Making the best out of an Accident
Mal
Maleficence
Malheur aux vaincus - Short stories
Malicious Arts
Malicious Arts: Astropolis Memorandum
Malicious, Magical, Malfoy
Malt the Manslayer
Malus Peior Pessimus
Mama Bear
Mana
Mana apocalypse book one becoming mages
ManaBorn
Mana king
Manapocalypse
Mana Rule
Mana's Champion
Mana System - Hello, World!
Mana Tank Magus
Mana : The Embodiment of Nature
Mana Unleashed Evolved
Mana World - Convergence
Mancers Grimoire
Man From Earth
Man from the machine
Man from the Machine - The third Order
Manifestations of faith: Return of the creators.
Manifest Fantasy
Manifest of Dao
Man in Demon's Skin
Manipulations
Mankind's Judgement
Man of Earth
Man of the Hot Spring
Manor on Server Seven
Manticore's Rise.
MANUS DEI (On hiatus. Pending rewrite)
Man With a Mace
Man With Many Faces
Maou Decides to Write a Shoujo
Maou Shoujo Magical Chaos
Maou : Summoning [Hiatus]
Maou the Yuusha
Maple Creek
Marae
March City (Project Lunation Book 1)
Marcus Dungeon
Margrave's Divinity
Maria's Adventure
Marionette of Chaos Magic: Evandaria
Marked Soul
Marked (The Crystal Saga series book 2)
Mark of a dragon
Marred Worlds [Discontinued]
Marriage And Monsters - An Eschatological Romance
Marrow
Marrow Marionette
MarSide (Oneshot/Teaser)
Martial Academy (武灵学院)
Martial and Soul Cultivation: Yun Xe
Martial artist on a Mage World
Martial Crafter (Stopped)
Martial Family
Martial Flame
Martial God has Some Magic Troubles
Martial God with Naruto System in Another World
Martial Legend
Martial Legend [DROPPED]
Martial Life Online
Martial Morpher
Martial necro
Martial path!
Martial Rebirth
Martial Road
Martial Spirit
Martial Spirit Ascendance!
Martial Void King
Martial World
Martial World & Summoned Hero
Martial World (Assasisin)
Marvel+DC
Marvel Fanfic: Umbra
Marvel Gets Bizzare
Marvel: We Are Venom
Marvel Wild Fiction
Mask
Masked Magicians: Savior
Masks: Greed
Masochism and psychopathy is my way of living
Masochist Berserker
Masquerade of Life
Master Alchemist
Master Bard
Master Dungeon Network
Master Exorcist
Master Healer, At Your Service!
Master Magician's Summoned Problems
Masternever And The Flow Of Death
Master Of All
Master of All, Jack of None
Master of All trades
Master of combat in a Different World
Master Of Dungeon
Master of Dungeons
Master Of Everything
Master Of Everything (Completed?)
Master of Experimental Magic
Master of Heaven
Master of Jade Cauldron
Master of Learning (Book 2)
Master of Learning (Color coded)
Master Of Music (may change)
Master Of The Dark Arts
Master of the Multiverse
Master of the Void
Master of Weapons
Master's Doll
Master Thief
Master Trainer Rei
Mastery
Masthead
Mated To You
Mathew The Mortal
Math God Plane - On Hiatus
Maths
MATHs − Maximum Acceleration of the Transcending Homo sapiens
Matt's Unfortunate New Life as a Woman
Matty's Misadventure
Max and Myx in Estrella
May Aien Have Mercy
Mayaken
Maybe it would have been a good idea not to wish for a harem?
Maybe it would have been a good idea not to wish for a harem? Completed
Mayhap Jak saga
Maze
MAZE- The endless quest
M-chan Wars: Rise and Fall of the Cat Tyrant
McShot's Crazy House: Many Stories in One Setting, It's an Anthology!
MCU'S Ghost
M'Destiny
MDW's WebNovel Incubator
Meakashi Collection
Me And My Army of Magical Beasts
Me and Myself (In Our Twin World Conquest Reverie)
Meaning
Meant To Be Rivals
Meanwhile
Meanwhile at the Withershins Inn...
Meat Eaters
Mecchen House
Mechanica Fantasy Offline
Mechanical Heart
Mechanical Sect
Mechanization against magic
Mechanoid Gear : Survivor of Trezallion
Mecha Stalin Massacre (An alternate-universe steampunk LitRPG)
Mech Domination
Mechshift
Mechs? Mex? Mex's mechs!
Medic!~
Medical Wolf
Medieval Centuries Online
Mediocre in Another World
Medusa and the blind woman
Meeting myself
Mega Cringe: Dab
Mega fantasy
Megane Saga
Mekaboru
melancholy Fox
Melancholy of the 31st Demon King
Melas
Melee Warrior of Combat
Meliar
Mellinnium Myths
Melvin The Necromancer
Memento Mori: Death Incarnate
Memoires of a Necromancer
Memoirs of a Monster Hunter
Memoirs of an old traveler:First Rebirth
Memoirs Of A Withered Flower
Memoirs of the Broken
Memoriam Mine
Memories in Purgatory
Memories Of Alice
Memories of a Trained Killer
Memorybound
Memory Seal
Me, My Car, and My Dreams Girl
Me, Myself, And I.
Me, Myself, And I. A journey with my Inner Dialogue
Mending Chaos
Menoitami
Menstex
Mental Note
Mental World Online
Mercenary King
Merchanicide
Merchant
Merchant Contract
Merchanting Around The World
Merchant of the End
Mercury Rising
Mercury's Daughter
(Merged into Burra: Short Stories In the Shaper Universe) Enlarge
Meritocracy
Merlin: The man who forged his own destiny
Messenger
Metagame
Metahuman
Meta-human: Brainstorm vs Omni
Metahuman Maiden
Metal and Magic
Metal Elemental
Metal Lich
Metallic Mind (working title)
Metal Samaritan (short story)
Metamorph
Metamorphosis
METAMORPHOSIS - devouring Its way to immortality
Metaworld Chronicles
Metempsychosis
Me, The World and Everything About it
Methodical Mind
Method Of Loci
Metropolis
Micah Ever After
Michael Ammers: My OP leisure life
Micro Evolution
Micro-Management: Survival Base
Midara: Paradox
Midara: Requiem
Midas Touch
Middle Management In Another World
Middle School Nostalgia
Midgard
Midnight Drive
Midnight in St. Petersburg
Midnight Moonlight
Midnight Moratorium
Midnight Raven (formerly known as: LazyTrash's Book-a-ma-bob)
Midnight Torches
Might of Alchemy
Mighty Sword King
Mikan Love
Mikayla the Dungeon?
Milky Way (Wuxia/Si-Fi/Space)
Millennium Dungeon: War
Million Choices
Millstones of Destiny
Milo
Milton
Milton Merryweather and the Terrible, Horrible, No Good, Very Bad Day
Mimicking The Gods [Hiatus]
Mimicking The Gods [Rewrite]
Mimicry New Life
Mimi O Saku
Mind
Mind Ambition
Mindcrawlers
Mindflaying Rebirth
Minding Others' Business
Mind Linker
Mind Net
Mind of a Healer
Mind of the Minotaur: Tower Seed
Mind over Matter
Mind Reading Isn't Cheating
Mindslaver
Mind Stealer
Mind your Manors, please.
Minecraft: A New Beginning
Minecraft power in a strange world
Mine from the Abyss
Minglings
Minigun & Magic
Minor Mage
Minute Cultivator: Greatest Anomaly Teleported Ever (A.K.A: THE ULTIMATE GENIUS!!!!) o^T-T^o do you even lift bruh?
Miracle [Book 1]
Miracle Child: Slash The Gods [Dxd Universe] . (Mature Content)
Miracle Match Making App (MMMA)
Miraculous Spider Man
Mironov
Mirror Mirror
Mirror World: The Citadel by Alexey Osadchuk
Misadventure of the Goddess of Death
Misadventures in a Cultivation World!!
Misadventures Of a Broken Dungeon Core
Misadventures of a Rampaging Demon
Mischievous Dungeon
Misery and Hope
Misfortune Night House
Mispaced Core
Missing Hattie
Mission Hearthwave
Miss Ophelia (A Draco Malfoy Love Story)
Missteps: A D&D Adventure
Mist
Mistaken Land: A Gamer's life in an another world
Mistakes Lead To Success
Mists of Ansehelm
Mists of Creation
Mists of Kel Doran: Season One - Dragon-Touched
Mists of Redemption
Mistworld - Book 1 - Couch Potato Chaos
Mite
Mithra
Mixed Martial Cultivator
MLG Gaming
MMO Earth - The Culling
MMORPH Dungeon for me,(it's just a side project)
MNR Apocalypse [PAUSED]
Mob Boss of stage 1 (Haitus)
Modern Age Online
Modern Cultivator - The Sperm Who Cultivates
Modern Day Avatar
Modern day Dungeon
MODERN DAY OP-NESS
Modern Deity
Modern Magician
Modern Magician In Another World
Modern Magus (Working title)
Modern OP game system... With a glitch! (DROPPED)
Modern Superpower In Another World
Modern Warfare In The Medieval Age
Modern World Mages
Modern World Reformation
Molten Core: The Ascension
Molting the Mortal Coil
Monarch of Heaven's Wrath.
Monarch of the Darkness
Monday Monster Girls
Money-Grabbing Daoist
Money Grubbing Demon Lord
Money Making MMO
Moniker's Mana
Monition of Magic
Monkeys are Amazing Creatures , Aren't They?
Monkey's Tail
Monochrome Bleed
Monok's Bones: Discovery
Monolith
Monolith of Progress
Monster
Monster and Cloud
Monster Apocalypse
Monster Brethren
Monster Buffet
Monster Calamity
Monster Core: Kill All Adventurers!
Monster Dungeon
Monster Eater: The Taste of Power
Monster Girl Fusion.
Monster girls in the modern world
Monster Integration
Monster island
Monster Made
Monster Made - Turned into a Monster
MonsterMancer
Monster Me
Monster No. 1
Monster of Elements
Monster Queen
Monster Sage
Monsters Cookbook
Monsters Dwell in Men
Monsters Dwell in Men - B2: Jehovah's Harmony
Monster's Embrace
Monsters Engineering
Monsters of Terra: A Compendium
Monster Soul Online
Monster Tamer
Monster Tamer in a World of Monster Hunters.
Monster Tamer In The Apocalypse
Monster Yurisume: My lesbian life with Monster Girls
Monstrous
Monstrous Intent
Monstrous Path
Moon Assassin
Mooncaller
Moonlight
Moonlight - Book I: Dusk [Completed]
Moonlight: Crimson Moon
Moonlight Færie
Moonlight Prince and His Uncertainties! (HIATUS)
Moonlight's Love
Moonlight Sword Sect
Moonlight wolf
Moonlit Blood
Moonlit sky
Moon Shaped Dreams
Moons of Orion
Moon Song (On Hold)
Moons' Shadow
Moral Complex
Morbid
More:
More luck than I expected?!
More than Human? (Hiatus until late June/early July)
Morgana
Morlock
Mormonism in Virtual Reality
Morph
M O R T
Mortal
Mortal Bodies, Timeless Soul
Mortal Energy
Mortal God
Mortalis Mortal
Mortal Minds
Mortal's Game (Gods Online)
Mortal Skill God
Mortis Operandi
Mortis Operandi 1- New Hire
Mortis Operandi 2 - Hostile Takeover
Mortis Operandi 2- Terms and Conditions
mortuis -The necromancer
Moskau by G. Zotov
Mossharbor
Most Wanted
Mother
Mother Nature
Mother of Learning
Mother of Monsters
M.O.T.H.E.R. Reborn
Mother World
Mountain Shelter
Mournebane: A world of swords, magic, monsters and dungeons
Mourners, Abednego, Persistence
Mourning Blades
Mourning Glory
Mourning Star
(Moved) RE: Divine Laws of Mind, Body, & Soul
Movie Central
Moving Fortress In Another World
Moving into an SSS Ranked Dungeon?!
Moving Sloth
Mr Dungeon
Mr.Easy's adventure in One Piece
Mr Mantis [Hiatus]
Mr. Moon Rabbit, I'm Not Yours!
Mr. Vampire's Wife
Mr. X
Ms Darcy's Apprentices
Mt. Tai in magic world.
Mud's Mission
Muffins the Barbarian
Multi-carnation
Multiclass
Multiversal
Multiverse Apocalyse
Multiverse Leaper [Dropped]
Multiverse with Ten Servants Powers
Muna Miracle
Munivit Anima
Murario 2177
Murder Eternal
Murder Hobo Society
Murder, Mystery, and Monsters
Murder of Crow
Murder Online
Murderous Loves
Murder the Mountains: A Dark Fantasy LitRPG
Murmaider
Murphy´s Law
Murphy's Law
Musica
Music Masters
Music Masters: CD One
Music System
Musings of the Secret Mortician
Must Protect The Saintess' Chastity! (BL)
Mutagenesis Phase One Dystopia
Mute
Mu: The Legend
Mutt
Mu Xiyun: A Lonely Laugh Travelling The Lakes And Mountains
Muzumi
Muzzle and Recoil: The Olympians [Temporarily Dropped]
My Ability
My adventures in Nope-World or How I came to Fear & Embrace the Horrors of 'Fantasy Australia'
My Annoying Aura Follows Me Into Another World
My another start in another world
My attack stat is negligible, so I can't help but rely on critical hits to succeed!
My attempt at writing a reincarnation Manhua
My Big Sister Is A Demon Lord | 我的姐姐是個大魔王
My Birthday Wish to be a Dungeon Master was Granted!
My Blind Familiar
My Bodyguard Can't Fight Girls!
My boring fantasy adventure
My Bride is a Moon Rabbit
My Career is Useless in this World!!
My Cerberus Girlfriend
My cheat skill sucks
My Classmate is QiLin
Mycology
Mycology, A VRMMO Story
My crazy little sister (arcadiablade)
My Cursed Beloved
My Daughter's Crown
My Daughter's Crown [Complete]
My daughter wants a Mommy
My Delinquent Sister Can'T Be My First Love...? | 我的不良的姐姐不可能是我的初戀...?
My Delirium Alcazar
My Demon Girl
My Demons
My Diary
My Dnd Characters
My Dungeon
My Dungeon Life: Rise of the Slave Harem
My Enemy Saviour
My Everyday Life With A "Harem"
My Experence in the Starcraft Universe
My eyes can see
My Fantastic World Of Magic
My Father is my Captain?!
My fiance is an alien
My Fiction
My first apocalypse
My First Party Member is a Slime
My first summoning
My Girlfriend: Death
My Girlfriend, the Necromancer
My Godly Body
My Good Friend Murphy
My Grudge is not ending!
My guild was transported to another world, but I'm just the Illusionist Enchanter
My Haiku Collection
My Happily Ever After
My Hermit Life
My Hero
My Hero Academia: Hero's Horizon
My Hero Academia: Pathway to the Top
My hero academia: Purple Tiger
My home is NOT your rest area!
My Hundredth Life
My insomnia is killing you
My job and adventure as a Technomancer
My Job is a Tailor
My Journey as the Fox head clan
My Lazy Days With A Fallen Angel
My Legendary Adventure
My Legend as an Evil Hero in Another World
My life after death
My Life as a Dragon's Assistant
My Life As A Fire Hero!
My life as a half-snake
My life as a human knight has begun
My life as a Hybrid
My life as a male harpy
My Life as an Teenaged Antagonist.
My Life As A Superhero Slash Supervillain
My life as Gohan
My Life,I'll lead it to full
My Life In Another Worl
My life in another world - isekai
My Life in Dragon Ball
My life in the anime worlds.
My life in Valhalla.
My Life is a Series of Questionable Choices
My Life is Not a Manga, or maybe...
My life is ruled by my character stats
My Life Jumping Worlds. (DROPPED DUE TO NEW VERSION!)
My life story in different world
My Life With An Overlord And Anime System.
My Life... With a Twist (will be on hold till summer break)
My Little Abomination
My little slave harem in another world!!
My Love for the Demon Queen
My Love Story
My Luck Was Used as Payment... (ON HIATUS)
My Martial Spirit is System
My Monster Adventurer's Guild
My Monster Boy Harem
My Mythical Odyssey
My Name is RUIN (The Chronicles of Pavel Maveth - Book One)
My Naughty Princess Consort
My Necromancer is a Lich
My neighbor is a ditto
My never ending cycle of Life and Death
My New Arcane Life
My New Life as a Crow
My New Life In Another World
My New Life on the Otherworld
My New World
My Next Life's Choices Are To Be The Next Demon Queen Or Holy Saint
My Nightclub Landlady
My not so Peaceful Dungeon Life
My Obsession
My Only Lorelei
My Orange Glove
My Ordinary Life
My Own Dragon System In Anime Worlds
My own world
My Papa is my Damon King
My parents are retired Superheroes
My Party Member is a Farmer - Literally
My Path of Justice
My Perfect Lady
My personal world
My power is actually really OP you know
My Psychotic Ghost Girlfriend
My Psychotic Ghost Girlfriend 3M
My Psychotic Ghost Girlfriend [COMPLETED]
My Real Empire
My real life Augmented Reality
My Reincarnated Life in a Fantasy World
My Revenge: For a lack of a Harem
Myriad Domain
Myriad Life
My Road to Become a Demon King
My Road To Glory
My Roommate is a Reptile?
My Sancutary is Purgatory
My Scary Wife Is So Cute
My School Is Transported Into Another World!
Myscreth
My second chance is as Dungeon Master?
My Second Life
My Second Life at Asura World
My Second Life: A Wishful Desire
My Second Life is an Absurdist Power Fantasy?!
My Second Time in this Terror-Stricken World
My Servant Is Too Overpowered!
My sexy childhood friend returned and...
My SF Gun Romance
My Shapeshifting Life
My Shinobi Academia: Rising
My Short Stories
My Sister's An Alien
My Sister The Villainess
My Soul is Yours
My Star
My Stepmother's a Witch
Mysteries of the Q Files: Rueben's Revelations
Mystery Dungeon
Mystery of the Dungeon
Mystfall Chronicles
Mystic Ink
Mystic ink: Mother's word.
Mystic Love Spells Trouble: Echo Encounter Volume 1
Mystic: Mark Of The Demon
Mystic Nan
Mystic Pharaoh God
Mystic Reality
Mystic Swordsman
My story Graveyard
My Story in the Otherworld
My Supers Online
My System Life
Mythalia : Dawn Of A New Era
Mythcraft: Heroes & Hellions
Mytheology
My Thesis Project Online
Myth Hunter
Mythical Conquest
Mythical Legends
Mythical Tyrant Ruler
Myth: Legend
Myth Of Men
Mythologia
Myth Online
Mythos Online
My Thoughts Exactly
Mythran's Master Of All - Continued
Mythran's Master Of All - Continued (Completed!)
Myth/Real
Mythril Mouse
Mythron Chronicles
Myths and Demons
Myths, Monsters, and Legends (Fate/Percy Jackson Multicross)
My Time to Shine
My Town's been Infiltrated by Monsters
My Trans-Dimensional, Overpowered Protagonist, Harem Comedy is Wrong, as Expected. (Oregairu/Danmachi)
My Travels Through Another World: A Dragon's Tail
My travel to a new game world
My Try at a Dungeon Story
My Tsundere Wife in a Different World (異世界で俺のツンデレ嫁さん)
My Usual Life With A Yandere
My Villainess Plans Were Ruined by my Brother!?
My Wish To Acquire 10 Wives
My Witch-Infested Life!
My world
My World Beyond the Closed Doors
My World To Live
My Youth love is a HAREM!!
My Yuri Adventure
NAAO: Serpent
NaClO Adventures
Nadia *Dropped*
Naga rising
Nagol: The Skeleton King
Nailed It
Nameless
Nameless: Ascent
Nameless Immortal
Nameless System V 1.00.008
Nandemonogatari: The Story of Something Else
Nanite: Infection (Book 1)
Nanite Magician
Nanite World: A Sci-Fi LitRpg set in reality
Nanocultivation Chronicles: Trials of Lilijoy
Nano Mage
Nanostar Short Stories
NanoTec: Flight to a Distant Star
[NaNoWriMo] Apocalypse Master
[NaNoWriMo] A Simple Life of A Farmer: Farming 101
[NaNoWriMo] A Tower of Hats
[NaNoWriMo]Author's Note
[NaNoWriMo] Don't label me!
[NaNoWriMo] I died and was resurrected... on Earth?!?!?!!
[NaNoWriMo] Masqueraider of Dofus: Incarnam
[NaNoWriMo] The Mortal God's Melancholy
Narbeleth: The Sword of Light
Narcos India
Narice Arkline and the Seven Element
Narice Arkline and the Seventh Element
Naruto: After the end.
Naruto Fanon — Generations
Naruto Fans In Another World
Naruto ? I should have chosen Pokemon
Naruto Otsutsuki "The Immoral Legend"
Naruto Retsuden: Toru
Naruto: The Game of Life
Naruto, The Mercenary of Fate.
Naruto: The Phoenix Wolf Jinchuriki
Naruto The Reincarnated Narutard
Narutoverse: Cultivation Style
Naru Tower: The Emerging Heroes
Naruto World Isekai: A new Flower Blooms in a Different World
Natalia
Natalia Nocte and the Arcadia Academy
Native Blood
Natural World
Nature Attribute
Nature is a Cruel Misstress
Nature Restart
Nature's Companion
Nature's Kingdom
Naulo's Corruption
Nav Station Algos
Nebulanomicon
Nebulous Fate
Necara Online
NeckBeard
Necromancer
Necromancer by Halosty
Necromancer of Valor
Necromancers Diary
Necromancer's Knight
Necromancer's Knight: a Light in Death
Necromancer'S Mountain
Necromancer's Pursuit
Necromancer's Resolve
Necromancy Domination
Necro-Merchant
Necropolis
Necrotic
Necrotourists: The Undead Living the Life
Ned (The weakest species)
Needle Guardian
Need More Points!
Needs More Monsters
NEET No More
NEET of God
NEET Re:Quest High School
Nefarious Affairs
Nefarious Alike
Neiero: The Journey(Dropped)
Neimein
Neither Snow Nor Rain
Nekana, One in Billions, Lost.
Neko Loli with Saiyan Powers goes on a Adventure
Nello & Pastrache ~2nd~ :: (The Reincarnation Story of A Dog in Flanders in an LitRPG Transmigration)
Nelvinus
Nemidos: Tales of a Summoner
Neo
Neo - A LitRPG Adventure
Neo Cosmos
NeoGaea
Neomegalith
Neon
Neon Dark: Zero.Hero Book 1
Neon Hunters
NeoRealm - Staring back into the Future
Neoshinkei [Cancelled]
Neos Online
Neo-Virus: #1.1 A Hare and A Mountain Lion
Neo-Virus: #1.2 A Robin and A Crow
Neo-Virus: A Robin and A Crow
Nephilim: Beyond Good and Evil
Nephilim: Descent [Dropped]
Nephillim: Children of the Origin Project
Nercokitty!
Nerds in Dungeonia!
Nereid
Neriehem
Nero, My Existence is Perfect
Nero Zero
Nether Gods
Netherland : The Owl Eater's Legacy
Nether Lord Saga
Netherwyrm god
Netsuzou Trap
Network
Neutral Chaos
Never After
Never Die Twice
Never Forgotten: The Dark Dragon Emperor
Never heard of that god? Well, wanna convert?
Neverland
Nevermore
Never Split The Party
Neverstar
Never the Hero
Nevertheless, A Fantasy World
New Age
New Age of Legends
New Age Online
New Australia (A LitRPG)
New beginning
New Beginning Online
New chance
New chance in fantasy
New Dawn- A Harry Potter Transmigration Fanfic
New Dawn Online
New Death
New Earth
NEW EARTH - A World of Chaos
New Earth System
New Earth- The Dungeon of Madness
New Eden Royale (A LitRPG Adventure)
New Era's Coming
New Escape
New Evolution 000
New existences
New Eyes
New Game+
New Game Minus
New Game Plus
New God
New hope online
New hope online: to
New Kingdom Come
New Lands Online Book 1: Encounters A LitRPG Series
New Legends
New Legends: A New Chapter in an Old Book
New Life
New Life +
New life for an immortal soul
New Life in AOT(Attack On Titan) World
New Life; New Hell
New Life Online
New Life Online: Battle Against The Strongest
New Life + : Sins of Olarene
New META Swordsman
New Origins Online
New Player Confirmed
New Race
New Reality [HIATUS]
New Reality Online(legacy)
New Roads
New Roads!
New Sorceress
New Soul
New Spartan
New: The Dark Inheritor
New to Magic
New To This
New Vista - The battle for 4th gen VR [participant in the Royal Road Writathon challenge]
New world
New World +
New World God
New World Order
New worlds
New world: Survival [Draft]
New World: The Clan
New World: The path of an avenger
New World: The Tales of Everything that is Wonderful
New World to Experience
New world, welcomes the overlord
New world, welcomes the overlord( hiatus)
New York by Night- Vampire Chronicles Book 1
Next!
Next Life: Awakening
Next Life: Reincarnated As an Elf
[Nexus] - Chaos Deficiency
Nexus (Practice Writing)
Neziah, The Glyph Born Lich
Nice Guy Syndrome
Nice things
Nico, The Lord of Nothingness.
NightFall
Night Game
Night Gaunt
Nighthawk
Nighthunter - Beyond the Black Gate
Nighthunter [hiatus]
Nightmare
Nightmare Infinity
Nightmare Online
Nightmares
Night Moves: An Urban Fantasy Adventure
Night Slaughter
Nights of Sambria: And the Wish of Light
Night Terror
Night Tremors
Night Visions
Nightwalkers
Nigmus Online [2nd Draft Complete]
Nihil
Nihil - Volume 1
Nihon no Niko
Niko and the parade of shadows
Nill 'The Zero'
Nimrien
Nina
Nine Artifacts, Elmyr's Last Errand
Nine Heads - A Hydra's Tale
Nine Realms VRMMORPG
Nine Rebirths [Title in Progress]
Nine Worlds Online [REV]
Ningen no Tenshi
Ningen no Tenshin
Ninja
Ninth
Nin the Seeker
Ninth World Lia's Struggle
Nirvana
Nirvana Sect Master System
Nirv the Ether System
Nite Errant
No.
No Absolution, An Antagonist LitRPG
NOAH Online -Global Beta Test-
Noah's Ark
No Angels
Noble
Noble Merc
Noble Sage
Noblesse Oblige: Ascendance
Nobody Expected a Normal Story
Nobody Understands This Sarcastic Young Master
Nocturne
Nocturne: Rise of the Heavy Metal Saint (Vol. 1)
Nocturne (Version 2)
No Easy Mode
No Evil
No Face, No Life
No Glory For You
Noh'Doum
No Heals!
NOIM; Connected Worlds
Noir
Noir:
Noire
NOIS: A RWBY fanfiction
NoiZ Online
No Level Up
No Life King
Noli Me Tank in a Mall
No limit
No Longer a Game
No Longer Alone
No Longer Human
Nomad Dungeon
Noman's Land
No Matter What, I Will Get Back Home!
No Mercy
No Mischief Allowed !
No Moon
No more TRY AGAIN button
(No Name Yet)
Non-Existing Killers
Non-fiction
Noodle Knight
No One's Hero
No Ordinary Hero
Nora and the Search for Friendship
No Regrets
No Respawn
No Respawn [Patch 2.0]
No Rest for the Damned
Normalcy is for boring people!
Normal Guy
Norseman of the south
Northern Cloud
Northern God
North Forest
Nosoi
NOSOI (dropped)
Nostalgia
NoS: The Crypts in the Shadow (Hiatus)
NoS: The Crypts in the Shadow Vol 1 (Hiatus)
No Strings Attached
Not A Hero
Not All Heroes
Not Another Fantasy Story!
Not Another Isekai RPG Story Alternate
Not another zombie apocalypse role playing game
Not as it seems
"Not Decided"
Notebook of possibilities
Note Red
Note the Night: Rise of Shadows
Not Getting Involved
Nothing but bones
Nothing goes the way I expect!!!
Not Hurt by the Frost
No time like tomorrow
Not Just Another Day
Not Many Get A Second Chance
Not Quite an Author (Yet) [inactive]
Not Quite What You Meant (Short Story Collection)
Not Reincarnation?
Not the "Support" you were expecting
Not This Earth
Not your average Bird
Not Your Hero
"Not your typical Demon King"
Nouvelle chance dans la fantaisie.
Nova
NOVA in the marvel cinematic universe
Novam Vitam
Nova Roma
Novarra
Nova Terra: Titan
Nova Vita.
Nova Vitam
Nova Vitam; A New Life in a 'New' World
Novo
Novos Hitchhiker
Novos Hitchhiker (Defunct)
Novus Lumen
(NOW EDITED WITH NO WALLS OF TEXT!)Age of Teras: Monster Evolution
Nowhere Island University
Nowhere to Run
Now I am Roselyn
Now That's Entertainment(a system apoc litrpg)
Nox
Npc
Npc 210M
NPC (First Draft)
NPC I want experience
NPCs are the strongest
NPC's Domination
Null un Voided
Numb
Numba Cruncha
Number One
Number One Commander
Number One Demon Under Heaven
Number One Under Heaven
Number One Under Heaven (Old Ver.)
Number One Under Heavens (Tian Xia Di Yi)
Numbers Continually Going Upward
Number Two Under Heaven
Nurarihyon System in Another World
Nuthouse
Nyaadventure: The Fluffiest of all story! [DROPPED T-T]
Nyanya N. Nya
NyaNyaNyaNyaNyaNyaNyaNya Meow Meow!
Nyix
Nyx - The Shadow Princess
O.A.I.
OAO - Olympian Anarchy Online
Oath
Oaths: A Tale of Two Brothers
Oban
Obey Me! x Reader - Oneshots? (Requests Open)
Obito's Mangekyō in Anime World
Oblivion Online
Oblivion Online (complete)
Obnoxiously Long Light Novel Title
Observation Calla Horizon
Observation of a Demon Tortoise
Observer 001's inter-multivursal log
Obsession x Mana
Obstacles
Occult Sorcerer
Oceanic reincarnation: The adventure of a little Triop
Ocean World of Chaos
Octopod
Odd Fate - What Other Side?
Odd, How I Got Here
Odd Jobs for a Occult Handyman
Odds
Ode to Freud
Odins Hall
Odin, the fallen god
Odyssey of Life
Odyssey of the Unrivalled
Of AI and Orcs
Of A Title That Is To Be Determined
Of Blood and Bones
Of Blood, Steel, and Lasers
Of Cats and Magic
Of Corporate Core Competency Plans, Capitalistic Synergized Growth Projections and Lethal Target Market Analyses.
Of Deities and Dimensions
Of Demons and Devils
Office Workers' World Transfer
Off Leash
OFFLINE FANTASY: Virtual Deities
Offliner(Cancelled)
Of Frogs, Ducks, and Other Things — A Compendium of Short Stories
Of Frost and Steel
Off the Vat
Offworld
Of Ghouls and Ghasts
Of Gods and boredom - Origin
Of Gods and Dungeons
Of Hubris And Heroism
Of Insanity and Chaos
Of Kingdoms and Empires
Of Lead and Steel
Of Life and Death
Of Life and Light
Of Men
Of Monsters & Men
Of mortals and gods
Of Ruin
Of Second Chances and Past Regrets
Of Swords And Wings
Of the Cosmos
Of the Dust
Of the Fifty-Two
Of The Last
Of The Nine
Of the Wicked
Of Us and Void
Of Wolves and Men
Oh.
Oh for the love of....why do I have a reverse harem?[COMPLETED]
Oh good, you're sane again.
Oh great, another dungeon reincarnation!
Oh My Beautiful Moonlight Goddess!
Oh no! My Master suddenly turned into ah...
OH Shit! I broke the seal!
Ohst, vol. 2 - The Beauhemian War
Okane o Subete Sekai e Chikara
Okane o Subete Sekai e Chikara - Money is Power in any World
Old Cultivation Record
Old Gods, New World
Old King's Resurrection
Old Man Logans: Transported to another world
Old Man's Adventure
Old Man's Game: Wanderer
Old Man Teaching System?!
Oldor father of magic
(OLD)Play On! My Lovely Goddess!
Old Riding Author Lunatic Asylum
Old: The Dark Inheritor
Old Version - The First Magician
Old World Online: A Scholars Ambition
Oliver Castle and the Dragonkeeper
Oliver's Wishes
Olympus
Omaye: The First Chronicle Of Zion
Omega A Legacy Reborn
Omega System
Omega Wave
Omen of The Days To Come (Title is a work in progress)
Omni
Omnia Online
Omnipocalypse Monsters
Omnipotent
Omnipotent Cultivation System
Omniscient daily research
Omni-System User
Omni-travel
Omniversal War
Omni-Verse Cleaning Monster
On a Blank Canvas
Once Again: Evolved
Once Again Online
Once a Hero
Once a Soldier Always a Soldier
Once Giants
Once Giants: The Neon Amazon
Once Human
Once Human, Now a Parasite
Once More
Once there was a cat... (Haitsu)
Once Upon a Box
Once upon a Night Time's Dream
Once upon a tomorrow
Once you go Wuxxia you never go back. [(A more or less serious 'Parody') More serious.]
On Darkened Wings
One Above All
One After Another
One among other
One among others
One Armed Swordsman
One Body Two Minds
One can only laugh in the face of destiny
One Chance
One Day Super Powers
One Death Forward, Ten Years Back
One Eyed Ghoul; a Tokyo Ghoul fanfic.
One Eyed Wanderer
One Giant Leap For Mankind
One Giant Leap For Mankind (Revised)
One Hamster Army
One in the Chamber
One in the Chamber [Discontinued]
One Life
One Look Man
One Look to Rule the Heavens
One man army in a marvel universe
One Man's Journey
One Man's Journey (2nd Draft)
One More Time!
One Must Understand
One Of A Kind
One of Eternity
One Of Many
One Of Many: The Story Of A Walking Bush
One of Shadows
One Online
One Piece: A New Player
One Piece Apocalypse
One Piece - Demon of the Ocean
One Piece: Harem King
One piece:master of the Z pirate
One piece My story
One piece: My story
One Piece No Go No Ken
One Piece: Pursuit of Justice
One Piece's Bloody Psychopath
One Piece's Messenger of the Sea
ONEPIECE the devil awakened
One Piece: The Elder Twin
One Piece: The Hundred Swords Pirate
One Piece: The New Age
One piece - Whatever story
One Piece World
One punch man (My style version)
One Punch Man : The New Saitama
One Punch of Justice
Oneshot - Jack of all Trades: Magical, Mystical, and Miscellaneous Services
One Sin
One Small Advantage (or Gamer who reincarnated (WITH CHEATS) after being VERY MAD at bugs in a game)
One Step Away From Hell
One Undead Man Armada
One Wish from Disaster
One with Betrayal
One with the Flow
One World Ends, Another Begins (working title)
(ON HIATUS) Immortal Mage
{ON HIATUS} Legacy Space Academy [18+] {Male Reader x Harem}
On Hold
(On Hold) Regarding my time being a God, it was fun
Onihc's Tale
Only Human
Only Human Online
Only Me
Only Me wasn't brought to another world, at least for now....
Only the Strong can Survive!
Onmyouji Eclipse
On Snowy Shores
On the backs of Dragons
On The Battlefield
On the Origin of Crows
On the Other Side
On the Outskirts of Minazuki
On the River
On the Road to Elspar (Book 1)
On The Road To Her Destiny
On The Run From A Dragon
On The Run: The Love Between Fugitives
On the Ship (girlxgirlxgirl)
On The Way To Als
Onyx's Assorted Ideas
Ooze
Open Fantasy
Opening an orphanage in another world
Open Source
Open World
Operation: Armored Warfare
Operation Re:Code - Project CELES
Operation Sexy Justice
Ophidian Aspect
OP-King and Goddess of Procrastination (Permanent Hiatus)
OPMC Harem Story
OP player in another world!
Oppressed
OP status copy/stealer
Optabilis Mundo: Shroud of Black Resort
Oracle by Default (Rewrite)
Oracle's Path
Oracus: The Lavorian Rider
Orange Days
Orange you glad to see this berry app(l)e-aling novel, it might even be pear-fect.
Oranthia
Orb Of Oblivion [Dungeon Story RE-WRITE]
Orc Calamity
Orc Demon
Orc Lord
Orc Planet
Orc Spawn (A LitRPG Story)
Ordain
Order
Order in Chaos
Order of Fantasy
Order: The Symbolic's Tale of Telekinetic and Family
Origin
Original Dungeon: Web Fiction Ruined My Reincarnation
Original unoriginality
Original Wolf - (Teen Wolf/ The Originals)
Original Wolf - (The Originals)
Original Word
Origin A.R.S.
Origin - Aszrad Online: Book One
Origin Dungeon
Originisis, Hero of protection!
Origin Manifest
Origin of Chaos (Rise of Anarchy Book 1)
Origin of Power
Origin of the Best Void Magician
Origin Of The Forsaken
Origin of the Invincible Merchant ( On Hiatus )
Origin Online
Origin Online - The Omnipotent Wizard
Origin path
Origin Point
Origins of Three Empires
Origins of Void.
Origin Story
OriginStory the VRMMO: The advent of AxeBear
Origin: The End
Origin: The Tale Of Isaac
Orion
Orivar: Deep Black
Oroborous
Orphan: A Journey of the Self
Orphans Band
Orphans of a Dead Nation
Ortum Dominus
Osaethar
Oscar Corvus by Raga
Other Earth (Through the Mist)
Other West: Diablero
Otherworld
Otherworld?
Other World Badass Minotaur or Not ?
Other Worlder
Otherworld Festival of Metallic Speed
Otherworldly Adventures
Otherworldly Chronicles of A Chronic Capitalist
Otherworldly Demon Fox
Otherworldly Emperor
Otherworldly Magicians Return
Otherworldly Teacher
Otherworlds
Other World Saint
Otherworld University (異世界大学)
Other World User Of The [system]
Other World User Of The [system] (Unfinished)
Otherworld Women Are Scary
Otsutsuki In The Celestial Realm
Our Blood Is Red
Our Chaoz ; Our Reality [New Breath]
Our Cosplay Became Real in Another World
Our Demons Within
Our Epic School Guardian
Our Goddess
Our Journey to the Other World
Our Mutual Ruins
Our new Home
Our New World
Our New World: The Beta
Ouroboros
Ouroboros Online Book 1
Ouroborus
Ouroborus Online
Our Peaceful Lives as an Isekai Pet Owner
Our Shattered Realms
Our World After
Outcast
Outer Demons
Outer Space Technology & Another World Magic
Out Foxed
Outlands
Outlasting the apocalypse
Outliers
Outlook: The Stars (Consciousness Unbound Book 1)
Out of Ashes
Out of Foxes to Give
Out of Place
Out of Space
Out of Sync
Out of Sync (dropped)
Out of the Blue
Out of the Forest, Into the Dawn
Out of the Motherland
Out of the Wilds
OutRage: Total Realism.
Out There
Outworld: Awakening
Over & Over
Overbalanced
Overgrowth
Overlink I:The Legend Of The Most Powerful Magic User
Overlord
Overlord Consultancy Firm
Overlord Gets Summoned
Overlord in Cultivation
Overlord of Sin
Overlord of the Spear
Overlord's Fall
Overlord Spirit Martial Emperor
Overlord's Rise
Overlord - The Beast of the Apocalypse
Overlord: The Untold Tale
Overmind - The Metamorphosis
Over My Undead Body
Overpower
Overpowered
Overpowered Death Mage In Another World
Over-Powered Guy In Another World
Overpowered Magus
Overpowered Sadistic Cat
Overpowered System!
Overrule
Overseer
Overseer (Dwarf Fortress x Worm)
Overthrowing Fate
Overture
Overture of an Odyssey
Overturning of Empires
Overwrite
Owning a cute little pet
Paalatoo
Paalatoo (Pet)
Pacific Rim - Overkill
Pacifist - Champion of the Death [ON HIATUS]
Pacifist Run
Pact
Pact Chronicle: A Magician's Story
Pact with a soul of hell.
Padding the Grade
P.A.D. World (Rebirth)
Pagebreak
Pains of Infinity
Painting the Mists
P.A.L
Paladin
Pal.Adin
Pal-Tee Planet: A GameLit/LitRPG Series
Palus Somni
Pan
Pancakes and rubber dildos
Pandæmonium
Pandemonium
Pandemonium: Struggle for Survival
Pandemonium: The Harbinger (Dropped)
Pandora: A New Beginning
Pandora Project
Pandora's Box, Repair & Service
Pandora's Game
Pandora's Scion.
Pangaea
Pangea: A New World
Pangea Online: Books 1 and 2
Panthea Online
Panthea Online: Side Quest, Player versus Player
Pantheon
Panzer Core
Panzerkai'd
Papercuts to Fell Immortals
Paper Ghost
Paper Houses
Paper's Cat
Parable of the Renegades
Paradigm Shift - New Beginnings
Paradise Unto Us, Virtual
Paradoxes have unlimited power...
Paradoxes have unlimited power...(dropped because whatever... or is it!?)
Paradox Fighters
P.A.R.A.D.O.X. Project Aeon Genesis: The Sin of Innocence
Paradox Space
Paragon
Paragon by Compass96
Paragon of Sin
Paragons
Paragon's Fall
Paragons of the Collective
Parallel (A Virtual Gamer's Story)
Parallel by Midnightsonata
Parallel Lives
Parallel Online
Parallels
Parallel (Vol.1 & Vol.2)
Parallel Vol. 3
Parallel World Vet
Paranoia!
Paranormal Relations
Parasite King
Parasite Paradise
Parasites and Magic
Parasitical
Parasitic Sword Monarch.
Parker, Peter Parker
Park to Hatfield
Parrain de Asesino
Partners In Death
Party Hard
Party Member For Hire
PartyO4
Passing Onto Fog
Passing Onto Fog / LitRPG Multiverse
Passion For Refining Pill
Pasted Gunner
Past, Present, and Future
Paternum: A Superhero Story
Path
Pathetic Plant
Path Evolution Johannes: The Shackled
Pathfinder
Pathfinders
Pathless - [Hiatus]
Pathless Origin: Bane of the Gods
Path of Ascendance
Path of a Wizard: The Cursing Skull
Path of Blood
Path of Damnation
Path of Evil
Path of Evolution
Path of heaven shattering
Path of Philosophy [Dropped...]
Path of Pure Evil
Path of Righteousness
Path of Slaughter
Path of the Dominator
Path of the Forsaken
Path of the Fused-Phantom
Path of the Glutton
Path of the Golden Average
Path of the Jade
Path of the Lilies
Path of the Mind
Path of the Thunderbird: Darkening Skies
Path of the Thunderbird Vol 2: Stone Soul
Path of the Thunderbird Vol 3: Demon Beast
Path of the Whisper Woman
Pathogen: Chrysalis of Monsters
Pathos
Path (Rewrite of Elf and monsters path)
Paths of Destiny
Paths of Life
Paths of the Chosen
Paths of the Chosen (Rewritten, Revised, and Reinvigorated)
Path To Adventure
Path to Godhood: The Silver King
Path to Godhood: The Silver King (RWBY)
Path to Immortality
Path To Obscurus
Path to Origin
Path To Redemption
Path to the Heavens
Path to Villainy: An NPC Kobold's Tale
Pathwalker: Into Darkness
Pathway of Butterfly
Pathway to Eternity
Patience is a Virtue
Patience Is A Virtue, Even In RPGs
Patient Zeroes
Patriarch in the ruins
Paw Luck (Litrpg)
'Pay to Win' Cannot Help-
Paztok
P.B.A. (Public Benefit Assassin)
PCS to Eden - (I'm on TDY from Hell Book 2)
Peace In Violence
Peace's Payback
Peace's Payback (hiatus)
Peak of immortality
Peaks of Power: Beginnings
Pearl of cold (Old version)
Pedlar of Another World
Peerless Daughter of Heaven (slow/random update)
Pellan Rise
Penance
Penance (rewrite)
PenDragon's PicToStory Challenge
Pendraguin
Penitent
Penniless
Penumbra
Penumbra Online: Quietus
People Are Stupid
Perchance
Perdition [ Scrapped Now] ~ Hiatus?
Perfect Blood
Perfect World
Perla Online: Toris
Perma-Death Online
Perpetual War
Persona: Greed of The World
Persona Influx
Persona Revolution
Perspective
Perverted God : Second Chance
Petal Fall: Eternal Border Of Life
Peter and the Computer Imp
Petilil - Bottom Up
Petmaster Evolutions
Pet Me?
Petrichor
Petrichor (BL)
Phaesporia
Phantasm
Phantasmagoria
Phantasmal Party
Phantasmic Light
Phantasm: The Grim Devourer
Phantom
Phantom!
Phantom Demon [Moved]
Phantom Lord
Phantom Moon
Phantom Path
Phantom Solstice
Phantom Song
Phantonics
phaseCore
Phenomenal
Philippine Lore
Philippines in Another World (Because Japan is too OP. Please Nerf)
Philosophy: Unchained
Phire Chronicles
Phoebe's Afterword
Phoenix
Phoenix Online
Phoenix Origami
Phoenix Rising
Phoenix Rising: The Beginning
Phoenix Rising v2
Photon shift
Pick Me Up
Pierce Through the Heavens and Slaughter Gods
P.I : Eternal
Pilgrim
Pilgrims of the Dying World
Pillars of Creation Online (Dropped)
Pill Master System
Ping Pong King
Pink Mage
Pink Sugar Apocalypse
Pinnacle [Dropped]
Pinocchio's secret
Pins or Die!
Pint-Sized Prompt-Fills: December 2017
Pioneer
Pioneer 0: Rise of the machine in a world of sword and magic.
Pirate's Gambit
Pirates of the Milky Way
P.I.R.A.T.E.S. (Profiteering by Instigating Random Accidents To Embezzle Shipment)
Pitch Black Dreams(Completed)
Pitt
Pivot
Pixelation: World Most Wanted
Pixie wife
PKKer
Plague Born
Plague Children
Plague Monster
Plane of Darkness
Plane of Darkness: The Battle Against Time
Plane of Darkness: The Beasts before Time
Planet #3
Planetary Avatar
Planetary Brawl
Planetary Update
Planet At War
Planet Evil
Planet Kill: A Dual Harem Pulp SciFi Adventure
Planetoid: The Legend of Aya Volume One
Planetouched
Planet Plume
Planet X: Chronicles of the Untiring
Player 47
Player 47 - Rewritten
Player Forty-seven
Player Glitch *paused*
Player Killer
Player reached the Top
Player reached the Top. BOOK 3
Player's Fall: NPC Takeover
Players of Reality(POR)
Player Versus Player
Playground of Fantasy
Playground of the gods
Playing with Opness!
Play It?
Play On! My Lovely Goddess! [Rewriting]
Playtime
Pleasant Nothings
Please Call Me Teacher!!
Please Don't Summon a NEET for a Wargame!
Plight of A Lost Soul
Plot Armor
Plot armour obtain
Plunder - Power Stealer
Pluto
Pocket Dungeons
Poetic moments
Poetry
Point Cultivation
Point of View
Poison in Paradise - A Star Wars Fanfiction
Pokemon Animus
Pokémon: A Story of the End
Pokemon: Becoming Legend
Pokemon Black & white: The Complete Story
(Pokemon Data-Visored) The Adventure of Viole
Pokemon: Hungry for Heaven
Pokemon Integration Project
Pokemon: I want to be a master
Pokemon New Age
Pokémon Quaran
Pokemon Reincarnated Adventure
Pokémon Reset Bloodlines
Pokemon: Successors of The Forgotten
Pokemon (The Kipy Life)
Pokémon The Legend: Ruby, Sapphire, and Emerald
Pokemon Untold
Pokemon - Vastia (Slow Update)
Polaris Dark
Polyglot ( )
Polyglot: Historia Online
polyglot("NPC_Revolution")
Polymath Redux
Polymath Redux Annex
Polymyth Equation
Polyrhythm time
Polyrhythm Time -- A Bard's Tail
Pond of Summoning
Poor Cultivation
Portal Problems
Post Human
Post-Living
Potestera- Race for Power!!!
Potter of Life Ariabel [Dropped until further notice]
Pound Of Joy
Powder Keg Balloons
Power
Power Fighters
Powerforge Girls
Powerful
Power, Game, System, Player
Powerless
Powerless Hero
POWERLESS: The Reborn Saga (NaNoWrimo 2017)
Powerless Villain [DROPPED]
Power Manipulator in DxD
Power Means Freedom, Right?
Power Quest
Powers of Majin Buu in a Fantasy World!?
Powers of Majin Buu in a Fantasy World!? (COMPLETED!)
Power Surge
Powertrip
Power Up
Practically, I am weak because "I AM A WEED!"
Pray
Praying For My Downfall
Preaching a Lie
Precious converting system
Precipice
Precise
Predating Oleander
Predator/Prey
Predators Dungeon
Predetermined Power
Prehistoric Barbarian
Prelude: Abyssal Tribulation
Prelude for the Crazies
Premiere End
Prerequisites for Greatness (RWBY)
Press Start to Play
Pretty Girl Problems
Pretty girl stranded in another world
Pretty Modern
Pretty sure i am not the main character
Prey
Prey No More *Dropped* (Probably)
Price of Ascension
PriCore Academy - Status : Zeros
Prides & Familiars - A Novel Series
Pride X Kämpfer ReVamp
Priestess Of The Land
Primacy Online
Primal Beast
Primal Cosmic Sage: A Marvel Fanfic
Primal Devotion
Primal Gaming: The Murder of Timothy Smithton: Part Two
Primal Will
Prime Dungeon: The World's First Dungeon Core
Prime Magus of Earth
Primeval
PrimeVerse Book 2
Primordial Evolutions
Primordial Flame
Primordial Kingdom
Primordial Law
Primordial Majesty (原始神)
Primordial Origins
Primoris
Prince of Destiny
Prince of Madness: Meteor Shower
Prince Of the Abyss
Princess
Princess Aria and the Gem of immortality
Princess Aurora - The hero villainess of another reality
Princess Dragonslayer
Princess Knight
Princess Knight [Revamped]
Princess Rinoa Reudinger
Princess Royale - A Novel Series.
Prince, You Musn't Fall in Love with Me!
Principled Jewellery
Prism
Prismatic: Tuscan Serpent
Prisoner From The Past
Prisoners of Earth
Prison of the Ancients
Private Academy System
Private Eye: The beginning of the adventure
Procession of the Shadows
Professor Fang
Professor Vare Wellington Of Magaming Academy
Profit Margin
Progenitor of Bloodlines
Progenitor of Mana
Programmica Magica
Programming Wizards!
Project: A.I
Project Alpha: A Summary - 'Old Republic to Current Operational Era'
Project Anastacia
Project: cure for those demons.
Project Cypher
Project Daily Grind (Mirror World Book #1) by Alexey Osadchuk
'Project Desperia'
Project Escape
Project Exonaut
Project Felia
Project G00
Project: Gate to new dawn
Project Ghost
Project Heather
Project Looking Glass: Freelancer
Project Love
Project: Massacre
Project Mirage Online
Project OMEGA
Project Ordinal
Project Pegasus
Project Pegasus: An Airplane Crashed into Me So I've Been Reincarnated as a Skeleton
Project reborn hero Ω
Project SHRINE
Project TheirWorld: Book One - The Tutorial
Project TheirWorld: Book Two - Tatterskin
Project: TheirWorld - Book Zero
Project: TheirWorld - Book Zero (Project TheirWorld: Book One - The Tutorial**)
Project X
Project Xero: Reblood
Project: You have died
Prometheus Code
Promised Daughter: We Call Ourselves the Cursed Part I
Promised Knight
Propellers
Proper Human Studies
Prophesy of the Elven King
Prophet of civilization
Prospect of Living in this Unforgiving World
Protecting Little Sister'S Smile | 保護妹妹的笑容
Protecting my sister's rivals
Protecting The MC as my game avatar in a wuxia world
Protection of the Vheil – Re-integration
Protector
Protector of the Realm
Protectors (HIATUS)
Prototype
Prototype for another world
Providence
Providence of Wisdom
PS Arcane Remove
Psychic Brawler Greg
Psychic desu ga, nani ka?
Psychic Maiden (Saikikku Shojo)
Psychics In Another World
Psychobox Robots
Psycho dungeon master
Psycho in a fantasy world
Psycho in an Unfortunate Apocalypse
Psycho in Naruto
Psycho Kaito
Psychopannychism
Psychopath
Psycho Space
Psychotic Break
Psychotic Death Online
[PUBLISHED] Substation Seven: Condemnation
Pun-ished Till the end
Puppet Lord
Puppet Master [A Boku No Hero Academia Fanfiction]
Puppet Puppet
Puranae
Pure Soul
Purgatory=Resurrection
Purge All Evil
Purple Flames
Purple Lightning Emperor
Purple Scales - A Reincarnation Story
Purrge
Pursuing the Demon Lord
Pursuing the Pinnacle
Pursuit Bloodline
Pursuit of Life
PvPer
PvPer Casual
PWNing P2W
Pyramid
Pyramid of Blood
Pyramid of Souls
Pyrion's Second Prince
Pyscho Bric
Qi and Other Diseases
Quality over Quantity
Quantum
Quantum Beginnings
Quantum Immortality - a Xianxia x Cyberpunk Story
Quantum Immortality - a Xianxia x Cyperpunk Story
Quantum Proliferation - Entangled Fates 2.0
Quantum Proliferation - Entangled Fates Book 2
Quantum Thief
Quartercup
Queen
Queen in the Mud
Queen of Ashes
Queen of Devouring (World System Reworked)
Queen of the Castaway Isle
Queen of the Hill
Queen of thieves
Queen's hubby
Queens (The Wielders of Arantha Book Two)
Quest for the Elysian Fields
Questing
Questioning the Basic
Questmaster
Quest of the Moon
Quests of Silence
Questworld Union Of Underworked Adventurers
Quicksword Bob
Quick Transmigration: Writer's Tyrannical Genres
Quietus
Quod Olim Erat
R1: "John's worries about his Harem" and R3: "The Magical girls!"
R3:Monochrome ~An Interactive Story
Raak
Rabbit Black
Rabid Animals, Fantastic!
R.A.B. Online (Discontinued)
Race of Culdovia
Races: Online ( VR Smartphone App)
Race to 100
Radiance Chronicles
Radiant Fantasy
Radioactive Evolution
Rae Daes
Raestta Online
Rage against Divine
Rage and rebellion
RagedEclipse's One-Shot Collection
Rage Summoner
Raghnall: The Tales of Valor
Ragna
Ragnarök
Ragnarok apocalypse, the primordial beast reversion
Ragnarok Chronicles
Ragnarök Delayed
Ragnarök : Guardians
Ragnar: The True Dragon
Ragnorok online
Raider
Raider (A VRMMO Novel)
Rain
Rainbow Destructor
Rainbow of the Horizon—Illuminating Our Darkened Path | Our World
Rain Colored Memories
Raine
Rain Revert
Rain Revert (Reboot)
Rainshade & The Golden Bullet
Rain Wanderer
Rakshasha's Heart - Prologue
R.A.M.
Ramblings of a Bored man
Ramz's Oneshot Randomness
Rancor
Random One Shots
Random Road
Random Story
Random Survival - An experiment into humanity
Random Wanderer
Random Words
Random Words - (A Series of Small Worlds Born from a Random Generator. Feel Free to Laugh)
Ranking S In Another World
Rank Zero: Cyberlinks Book 1 (LitRPG)
Rantings of the Broken
Rapture: The Bloodstained Chronicles
Rapture: The Bloodstained Chronicles (prototype)
R. A. T. H
Rat In The Dungeon
RATS: 252 Chances At Redemption
Ravaged
Ravana
Raven
Raven Eyes
Raven: Player Kill (Prologue) aka: How to make a realistic yandere.
Ravenport: Luna's Awakening
Ravens of Death (#2 of HOW)
Raven Squad > The Outbreak
Raven's Tale
Raven: The Beginning
Ray-004 (Completed)
Ray-004 (Dropped)
Ray-004 (Ended)
Raylia
Raymond's Raven
Ray's Redemption
RE: 10 Lives
Re:Absorb
Re:Absorb Redux
Re: Accel Rush
Reach For the Stars
Reaching for Immortality
Reaching for One's Desire: Kane's Ascension
Reaching for the stars
Reaching Immortality after Death
Re: Admin
Ready Player Bun
Real
Real dungeon in real life.
Reality
Reality Benders: Countdown by Michael Atamanov
Reality Crash
Reality Drift
Reality Drift: I am out of the System (LitRPG)
Reality Grants One Chance
Reality in a Game World
Reality Meets Myth
Reality or Game
Reality or Not
Reality's Gate: Stealing The Gifts Of The Gods
Real Life Can Be Interesting Too
Real life in a Virtual World.
Real life offline
R.E.A.L. Life Online: Inception
Real Life RPG Doesn't Suck
Real Life RPG Sucks...
Realmbound
Realmcusp Tavern
Realm Design
Realm Eternal
Realm of Adventure - Volume 01
Realm of Exaltia
Realm of Infinity
Realm of Learning: Adventures of Eternium
Realm of Legend
Realm of Mages
Realm of Myths and Legends
Realm of Noria. Book 1. The Birth
Realm of Noria [LitRPG series. Book 1. The Birth]
Realm Of Olde
Realm Of The Forgotten Gods
Realm of the Stars Volume III: War for the Crown
Realm of the Stars Volume II: The Endangered Crown
Realm of the Stars Volume I: The Unclaimed Crown
Realm Online: Trapped
Realm Online: Trapped - An Epic Fantasy LitRPG Adventure
Realms
Realm Walker
Real Real Life
Real Time Dungeon
Real Time Reality
Re: Answer
Re:Ant
Reaper
Reaper Ex Magus: Highborn Herald
Reaper main in another world
Reaper Of Souls - Messorem Animarum
Reaper of That Which Was Sown
Reaper of the Martial World
Reaper of the Multiverse
Reaper of the Shadows
Reaper's Game
Reaper's Grimoire
Reaper With The Red Hair
Reaping Pendant
Reap the Heavens!
Re:Arbiter of Power
Re:Armor
Re: Arms and Magic
Re: Ascension Rebirth
Reason For Regulation 7865544329
Reasons to Stay
Re:A Space Story.
Re:Asura
Re:Beak
Re: Beast
Rebel - An Uni Online Tale
Rebel Arcana
Rebellion of the Exps: Exp 8
Rebirth
Rebirth+
Rebirth and Second Chance [Dropped]
Rebirth as Evol a certain evil goddesses's stupid mistake
Rebirth Back To Another Parallel World (Zombies)
Rebirth, but not quite.
Rebirth: Hero! [Discontinued]
Rebirth in a corrupt world
Rebirth in a Magical World
Rebirth in a parallel world
Rebirth into a Magical World
Rebirth: Monarchs
Rebirth: New World
Rebirth of Abium
Rebirth of a broken demoness
Rebirth of an Accidental Demon Queen
Rebirth of an Immortal
Rebirth Of A Serial Killer
Rebirth of Assassin
Rebirth of Chaos by Lazyanona
Rebirth of Fallen
Rebirth of Gu Jiao
Rebirth Of The Commando
Rebirth of the Cultivator in the Apocalypse
Rebirth Of The Elder Lich As A Devine Being In The Mortal World
Rebirth of the Entertainment Giant
Rebirth of the Evil God
Rebirth of the Fallen
Rebirth of the heart of Arcturus
Rebirth of the Heavenly General
Rebirth of The Kind Death God
Rebirth of the Mind
Rebirth Of The Shadow
Rebirth Of The Strongest Genius
Rebirth of the Sword Emperor
Rebirth of the Sword Emperor(Original version)
Rebirth of the undead
Rebirth of the Undead King
Rebirth of Versatile Mage
Rebirth Online
Rebirth Online V3
Rebirth: Rise of the Slave Master
Rebirth: The badass young lady
Rebirth To a New World with Nothing but One Magical Slime
Re;Blade
Rebola
RE: Books
Reboot
( REBOOTED ) Reincarnated Inside (RPG GAME) With Modification System
Reboot - Hiatus
(Reboot up)
Re:BoredBlood
Reborn
Re:Born
Reborn: Apocalypse
Reborn As A Cute Loli
Reborn as a Dungeon Boss
Reborn as a Fantasy World Dungeon
Reborn as a GOD [Re-written]
Reborn As A Hero...... But Why Did I Freaking Turn Into A Girl?!
Reborn as a Magical Girl Villain
Reborn as a Mana-beast, but……why am I a panda?
Reborn as a Nano Drone
Reborn as a nine-tailed fox
Reborn as a nine-tailed fox [Rewrite]
Reborn as a Royal
Reborn as a Shinobi from Another World
Reborn as a skeleton because I'm edgy
Reborn as a Tentacle Monster
Reborn as a Zombie Plague
Reborn as Kurama: applying scientific method
Reborn as Living Mana
Reborn as the Founder's Descendant, Bringing Change
Reborn as villainess girl....
Reborn in abyss
Reborn in another world, as a male?!
Reborn in another world with a glass of water
Reborn in Dreams
Reborn in Konohagakure
Reborn in Marvel??
Reborn in MHA
Reborn in RWBY
Reborn in Tales of Demons and Gods
Reborn in The Marvel World
Reborn into a RPG?
Reborn into a Xianxia World
Reborn into BNHA
Reborn into Naruto with full Hollowfication!
Reborn into Starwars! Summoned into Fantasy
Reborn into the Magus World
Reborn into the RWBY World with a Small Cheat
Reborn loser
Reborn Magician Tyrant [Old]
Reborn on a Systemless Earth... With a System
Reborn on a Systemless Earth... With a System -- A Reverse-Isekai Adventure
Reborn Online
Reborn (Proof of concept)
Reborn - The Last Dungeon
Reborn: The Seven Realms
Reborn-----the unexpected tales
Reborn: The Unexpected Twist
Reborn to become the boss of the Strongest Mafia
Reborn to purity
Reborn----unexpected opportunity
Reborn with 1600 IQ
Reborn with a maxed out intelligence skill
Reborn with a Spotted Back
Reborn with the All-Seeing-Eyes
Reborn: Wolf Man
Re: Bow
Re:Box
Re: Branch member
Re: Breakthrough
Rebuilding the Sun Kingdom!
Rebuilt By Force
Re: Butler - Otaku Butler meets his Master in Another World?
Recalcitrance
REC Company
Re:Chances
Re:Cheat
Re:Chimera
RE: Choice
Re:Chomper
Reclamation
Recompense
RE:Conquest
Re: Conquest
RE: Cooking knife
Record of a Sovereign
Record of Naruto Verse
Record Of The Immortal Teacher
Record Of The Immortal Teacher (ON HIATUS)
Records of Ren
Records of the Blue Dragoon (TOG)
Records of The Last Land
Re: Corruption
Recovery: Ignis
Recovery of a Life
RE:Creation
Recruit - An Infinite Labyrinth prequel
[Re] Cultivating the Universe
Recursion
Red
Red and White's little conversation corner (Side-story)
Re Darknym
Red August
Red Beans
Red Butterfly - Spirits
Re:Deathclaw
Re: Death's Melancholy
Re:Demon
Re: Demon
Re:Demon Hunter
Re: Demon Lord
Re:Demon Lord
Redemption
Redemption: a Pokemon story
Redemption of death
Red Expansion
Red Eyes
RedHawk
Re?digimon?
Re?digimon? It is Not! Damn it! What the heck is this?!
Re: Divine
Red Lanterns Rage (on pause)
Redlined Fury
Red Mantis and Avenger Doll
Red Moon
Red Moon Cafe
Re: D.O.A
Redouln Rising
Re: Dragon ball [Cultivation]
Re: Dragonize
Re:Dragon Princess
Re:Dragon,Reincarnated to Another world As a Dragon
Re: Draugr (Dropped)
Red Road
Red Scale
Red Scarf
Red Skies: Worlds End
Red Souls
Red Stardust
Red String OF Fate
Red Swan
Red Thread
Red Thread of Fate
Red Twilight God of Hunger
Red twilight Hunter's Chronical
Red Twilight Volume 1 : A Dawning of Power
Red Twilight Volume 2: Long Distance Runners
Red Twilight Volume 3: Worldwalker
Red Twilight Volume 4: The Avatar Awakend
Re: Dungeon Conqueror
Red Wolf
Redwood Crossing (Fantasy/Yuri)
Re: Dystopia (Completed)
Re:Eclipse
Re: Elemental God
Re:elemental The Greatest Spark [Hiatus]
Reel or Real
Re: Ender dragon
Re: Ender dragon. dropped
Re: Ent
RE:Epsilon
Re: Evolution Rise of the Codex
RE:Exiled Royalty
Re:Fantasy
Re:Ferret
Re: Fire
Reflections: Memoirs of a Minder
Reflections: Memoirs of a Minder Book 1
Re:Flight (Dropped)
Reforging theBroken Warrior
Reformat: Adventures of a Battle Academic in a Primitive Land
Reforming a Demon Queen
Regalia Online
Re:Game of Thrones: Play The Cards You Are Dealt
RE: Gamer
Regarding a Certain A.I.
Regarding my Reincarnation as an Incubus
Regarding My Reincarnation into the body of an Automaton Girl!?!
Regarding The Life of A Certain Fallen Noble
RE: Gargoyle
Regenerator
Re: Generic Isekai - An Isekai with a loooooooooooooong title.
RE: Generic Isekai – An Isekai with the longest title on this website and it's totally lame so will you read it?
Regent D
Re:Ghoul
Regis
REGIS the Forgotten
RE: Goblin
RE:God
Re:Golden Age (Inactive)
Re:Grave [Dropped]
Re:Guardian (dropped)
Re:Hammer
Re:Hammer (Finished)
Re:Hammer - The Hammering
Re: Harpy
Re; Hell Gate
Re;Hell Gate (OLD)
Re: Hero and the Demon King
Re: Heroes' Mount
Re:Hero's Weapons
Re: Hero's Weapons: Reborn
Re:Hulk
Re: Human
RE: HUNDRED -Starting Life in Another World-
Re: Hunted
Re:Hunter
Reicarnated: Dragon-kin
Reign of Darkness
Reign of the first Dynasty
Re:Immortal
Reincarated Into A Anime World
Reincarnaction Is strange
Reincarn-AI-tion
Reincarnate: Avolved (ABANDONED)
Reincarnated and then summoned to VR
Reincarnated As A Created Player
Reincarnated as a Cursed Armor
Reincarnated as a cute little wolf!
Reincarnated as a Demonic Entity
Reincarnated as a Dragon!?
Reincarnated as a Dragonman (On Hiatus)
Reincarnated as a goblin
Reincarnated: As a love doll
Reincarnated As A Mob!?!Rise of the Demon
Reincarnated as an Angel- To become the next God Of War
Reincarnated as an Avatar Class Titan in a Fantasy World
Reincarnated as an elf!
Reincarnated As An OP Dungeon
Reincarnated as an OP Loli
Reincarnated As An OP Paladin
Reincarnated As An OP Paladin [New]
Reincarnated As A OverPowered Dragon
Reincarnated as a Pillbug monster
Reincarnated as a Prince but got abandoned afterwards
Reincarnated as a shark, Became a planet
Reincarnated as a Team Rocket Member?!
Reincarnated as a Tree
Reincarnated as a Troll, how can I stop humans from hunting me?
Reincarnated as a Troll in a Dark Fantasy World
Reincarnated as a Wolf monster in another world?
Reincarnated as a Xenomorph in a Fantasy World!
Reincarnated As Pain's Secret Weapon (Naruto OP OC AU FF)
Reincarnated as the Fated Villain
Reincarnated as The Main Character Little Sister and....I Just Don't Wanna Die Again
Reincarnated as the mother of a villainess of an otome game?!
Reincarnated as the Villainess Older Brother?!
Reincarnated by the God of Creation
Reincarnated Cat Becomes a Magical Beast
Reincarnated Corpse
Reincarnated genius
Reincarnated Genius: My wife is more op than me
Reincarnated Hero Kills The Summoner
Reincarnated : He's my WHAT?!
Reincarnated in a Generic Fantasy LitRPG World! With a System Too!
Reincarnated In a Naruto like world
Reincarnated in a new world with a new life
Reincarnated in Another World, the Adventure of the Pyromaniac Prince
Reincarnated in Dragon Ball world: stuck as SSJ5
Reincarnated in Naruto
Reincarnated Inside MU ORIGIN (RPG) With A System
Reincarnated in the world of Ishtaria
Reincarnated into a Lovey Dovey Otome Game World-Who gives a bleeper?
Reincarnated into a Modern World
Reincarnated Into Another World With Fairy Tail System
Reincarnated into a weak god
Reincarnated into a Zombie Apocalypse Trying to Rebuild a Harem as a Zombie
Reincarnated into the DxD World?! (Anomaly #1)
Reincarnated into the World of Naruto
Reincarnated into What?
Reincarnated, I will become the Strongest!
Reincarnated Legendary Contract Killer
Reincarnated, let's be a pirate.
Reincarnated, Now What?
Reincarnated Supreme Commander General
Reincarnated! The Blind and Deaf Boy
Reincarnated to Another World, But I Think I'm Too Strong.
Reincarnated to immortality
Reincarnated White Beastie
Reincarnated with a Beauty Summoning System
Reincarnated with a living archive of sorcery
Reincarnated with the same world just like Nar***'s?! meh...
Reincarnated Wolf
Reincarnate in Anime world
Reincarnate into Another World as a Bicycle
Reincarnate Into New Worl With Cheat.
Reincarnating into a Fantasy world as an Autonomous Machine Arsenal
Reincarnating into a Skleton Monster
Reincarnation
Re: Incarnation
Reincarnation as ???
Reincarnation as a demon: Path to Demon Lord
Reincarnation at the Naruto World
Reincarnation Brought Me To An Otome Game World
Reincarnation Cycle Of Multiverse
Reincarnation: EVOLUTION.
Reincarnation Evolution - Is it Darwinism or Metamorphism?
Reincarnation: First Monster
Reincarnation Flower
Reincarnation Games.
Reincarnation Games:Dark Wisp
Reincarnation Giver (Editing in Process)
Reincarnation: I am the Villainess and Love Target?!
Reincarnation: Immortal Path
Reincarnation Luna (On Hiatus)
Reincarnation: Mage Lord
Re:incarnation - Magic Zero
Reincarnation Monster
Reincarnation of an Anomaly
Reincarnation Of A Phoenix
Reincarnation of a Rank 9 Magus
Reincarnation of Napoleon: World of Cards
Reincarnation of Strongest Sword God - Continued (a fan fiction)
Reincarnation of The Butcher Alchemist
Reincarnation: Rise of the Rodent
Reincarnation Royale
Reincarnation, Slime, and The world
Reincarnations of a Hero
Reincarnation That Everyone Desires
Reincarnation, the beginning.
Reincarnation with an Omniscient Grimoire
Re:Incubus
Re:Insanity
Rein's Reign
(Re)Install
Re:Interference- Did something go wrong with my Rebirth?
Re: It wasn't a dream!?
Rejecting the tides
Rejection (completed)
Rejoice
Re-Journey
Re: Killer Rabbit
Re: Kingdom
(re) Kobolt on Yggmathall
Re:Labyrinth
Re:Lamia
Re: Legion
Re: Legion (Indefinite Hiatus)
Relevance
Relevance And A World Flying Off The Tracks
Relics
Re:life-Little girl in big world
Re:Light
Relik
Reliving my novels as the antagonist?!
Re: ;Living/Surviving (Barely) in this new world as a Cactus
Reliving the Past ~ Mage of the Abyss
Re:Loner - Social Skill
Re:Lovely
Remake is out. (New Name is Masked Hero: The First)
Re:Mana Spirit
Rememberance
Re: Member [HIATUS]
Remember Me Fondly
Remembrance
Re: Merlin In Another World
Re: Mess Up Angel by Vincent84
Re: Mimic (Currently on Hiatus)
Reminiscence
Remnant.
Remnants of Scientific Mankind
Remnant Stars
RE:Monkey
Remorse
Re: Mountain God
REM Universe: Dreams or Nightmares
Re:music
Ren 10 (a Ben 10 fan fiction)
Re:Naruto
Re: Naruto.
Renascence: War of the Zodiacs
Rend
R.E.N/D
RE: Necromicy! The Mouse Necromancer!
Renegade
Renewal and Rebirth
Renewal Eternal
Re:No Target
Renowned
Re:Nymphs
Re:Ocean
Re: O.I.
Re:Oni
Re:Oni /Dropped/
RE: Orc
Re:Otaku Prince life in another world
Repeat
Re:Pebbles
Repentance
Re: Pessimist
Re:Player
Re: Pokemon Red
Report file 2785: Galactic Unravel
Re:Primordial Beast
Re:prince Otaku's life in another world
Reprise
Re: Progenitor
ReProject- Sealed Memories
Re:ptile
Reptile At Range
Requiem
Requiem of Souls
Requiem of the Unliving
Requiem to the Stars
Require: Cookie - Book #1 - Mirrorfall
Re: Rabbit Eyes
Re: Rabbit Eyes [Draft]
Re:Ranger
Re: Reader interactive
RE: Rebirth Online
RE: Rebirth online.
Re: Reincarnation: EVOLUTION
:Re.re.Re: (Completed)
RE: Rise of Anubis, LitRPG Fantasy (First Novel)
Re: Rise of a Side Character
Re: Rock
Re: Sanguine War Era
Re:Savior Or ærdéaþ
Rescendence
Re:Serpent, the Struggles of a 'Snake' to Survive and Evolve...
Reset
Re: Seven Lives
Re:Shard
Re:Shard - Due to RL issuse uploading is very slow, but still undergoing and not yet dead
Re:Shinobi
Re:Sim
Resistance is Futile
Resist The Blackness
Resist: The Scourge Wars Book 3
RE skeleton
Re:Skyrim
Re: Slave
RE:Smith
Resound and Shatter
RE: Space Shoujo
RESPAWNED: New Game Plus
RESPAWNED: Original Timeline
Respawned: The Uncharted Lands
Re:species
Re:Spider
Re: Spiderling
Respite of a Fallen World
Responsibility
Res Publica: Republic Among Monarchs
Restart
Re:Start
Re: Start
Restart!
Restart Again: Volume 1
Restart (Level Up - 1) by Dan Sugralinov
Rest in a Demon's Embrace
Re:Stoat
Re:stones
Restoration Earth: Load
RE:Summon
Resurgent
Resurgent [Hiatus]
Resurrection: I died and came back as a 3000 year old vampire!
Re:Sword
Re: Sword Emperor
Re: Sword Emperor (old)
[RE] System
Re:Terra ignota
RE: The Art Of Power- Volume 1
Re:The Awful story
Re: The Ultimate Divine Reborn Unbound Cultivating Emperor Dragon Assassin Summoned to Another World : Online
Retired emperor
Retired Hero to --- (working title)
Retiring to the Boundless Realm
RE:tombdungeon
RE: Trailer Trash
Re: Transport to Another World as My Game Character!
Re: Trump: Online
Returned to Earth as the Wolf God
Return From Fantasia
Returning
Returning to Legacy
Returning to the Apocalypse
Return of the dark god
Return of the Dark Gods - A WitchBoard Novel
Return of the Demon Lord
Return of the Last First Lord
Return of the Last First Lord (Revised Edition)
Return of the Margravine
Return Of The Martial God
Return of The Ruler
Return of the Soldier King
Return to Earth Realm
Return To Godhood
Return to the Fairies
Re:Utopia
Re:Vamp
Revant
Re:Veggie ;Living (Barely surviving) in another world as a plant
Re:Veggie ;Living (Barely surviving) in another world as a plant (Beta)
Revelations Online
Revenant Faith and Foreign Pilgrimage
Revenge in another World
Revenge of the Dead
Revenge of The Disturbed
Revenge of the Golemman
Revenge of the Sorcerer King
Revered Expert of Virtual Reality
Reverence of the Weak Minded (Zūnjìng yìzhì bóruò)
Reverie
Reverse Fantasy online
Reversing Supernova
Reversion
Revival
Revival of Undead King
Revival Quest
Revived as an Emperor with Three Wives
Revive, Reincarnation, Return
Revive Unlimited: War of the Paladins
RE: Void
Revolt Against the Heavens
Revolution
Revolutionary against the revolution
Re:volutionist
(R)Evolution of zombie
Revolutions
Revolution's Path
R.Evolution- The Border Dispute
Re:Volve
Re:Warrior
Re: White Slime Knight
RE: Wisp of the Elves
Re:wolf
Re:World
Re:World Online
Rewound and Rewritten
Re:Write
(Re-write) House Cazador: The Imperial Lion
(REWRITE) The Golden Watch Of Hypnosis
Rewrite X fate
Rewritten ascendacy
Re:Xianxia
Rexist
RE: Young Master
Rhapsody
Rhapsody of Fate and Origin
Rhucon
Rhythm of Rampage
Ribbit ! I became a frog.
Rica Wants Him Dead
Richard Anderson and Grand Survival Games
Richard the Paladin
Rich Sex (Not Suited For Everyone)
Ricochet Island
Riddick/ Against the Heavens
Rifle Girls in Monaco - a Rica Reyes Adventure~
Rift of the Oculus
Rift of Worlds
Rift Walker
Riftworlds Online Book 1: Space Opera
Rigel: The Savage World
Right as Rage
Righteous Bestowal: Emperor of All
Righteous Fox Immortal (Going through rewrites)
Righteous Fox Immortal (Small Hiatus)
Righteous Prosperous Malicious
Righteous Sovereign
Righteous Sovereign, Shameless Rogue
Right Hand of God
Right Side of Hell
Riley's second chance
Rina, the Dragonslayer
Ring of Promise
Rinnegan Wielder In Another World
Ripple in Time
Rise
Rise And Conquer
Rise (A superhero serial)
Rise From Modern To Fantasy!
Rise of Agze'sCanvas
Rise of an Adventurer
Rise of an Emperor [Dropped]
Rise of Anubis - LitRPG Fantasy
Rise of a Renegade Prince
Rise of a Rogue Dungeon
Rise of a Scarlet Devil
Rise of a Scarlet Devil (Regular+Draft Version)
Rise of Demon King
Rise of demons
Rise of Emperors: The Creepy Ice Mage
Rise of H