|
𝕽𝖊𝖇𝖊𝖑𝖑𝖎𝖔𝖓
|
"Because I am Tianzi Daiyu!"
|
"Conquerors Domain" By xipzo
|
"Fight!"
|
"God's" Door
|
"I Am The Hero"
|
"Not Decided"
|
"Not your typical Demon King"
|
"Reincarnated?" Only To...
|
"Talented"
|
"Untitled"
|
"What do you mean, 'You're an ex-familiar'?!"
|
"Why Does My Crush Have Tentacles!?"
|
"Without You". Reincarnated as a Troll Alternative. 2018' NaNoWriMo
|
# Gaea 1 - Blood of the Pure
|
# Gaea 1 - Blood of the Pure (COMPLETE)
|
# Gaea 2 - Light of the Shadow
|
# The Gemstone of Ominium 1 - Denial
|
#1 Shadow
|
#199
|
#Zero Wonderland (Code Zero Wonderland)
|
>Input Log Dates
|
<< Lucid Dream >>
|
'Daikon' Ball
|
'Pay to Win' Cannot Help-
|
'Project Desperia'
|
'S Demise
|
( REBOOTED ) Reincarnated Inside (RPG GAME) With Modification System
|
(BL) System, WTF!
|
(Cancelled) A Purgatory Beast's Summoning
|
(Cancelled) The Shadows Embrace Me
|
(Defunct)Spaceship Reincarnator
|
(DEMO) Colorless vol.1- Phantamoire Enigmata
|
(Discontinued)
|
(Discontinued) Aevitas - Not an NPC
|
(Do) Re:Mi
|
(Draft 1- Not Latest Release) Becoming the Protagonist of My Own Delusional World!
|
(Dropped) - Gachapon
|
(Dropped) Crown of the martyr and martyr of the Crown.
|
(DROPPED) The Snake of the Fan
|
(Dropped)The Ancient
|
(Dropped)The God Of Apocalypse
|
(Game + Divinity) - Heroics = Our Reality
|
(Hiatus) Dungeon Defender
|
(Indefinitely paused) The Stone-hearted Enchanter
|
(Merged into Burra: Short Stories In the Shaper Universe) Enlarge
|
(Moved) RE: Divine Laws of Mind, Body, & Soul
|
(No Name Yet)
|
(NOW EDITED WITH NO WALLS OF TEXT!)Age of Teras: Monster Evolution
|
(OLD)Play On! My Lovely Goddess!
|
(ON HIATUS) Immortal Mage
|
(On Hold) Regarding my time being a God, it was fun
|
(Pokemon Data-Visored) The Adventure of Viole
|
(R)Evolution of zombie
|
(re) Kobolt on Yggmathall
|
(Re)Install
|
(Re-write) House Cazador: The Imperial Lion
|
(Reboot up)
|
(REWRITE) The Golden Watch Of Hypnosis
|
(Suspended) The Helix; The Arc,
|
(The Convertion)
|
(Un)Luckiest Person On Earth?
|
(un)Lucky
|
(Un)Paralleled
|
(Un)Prophesied Heroes
|
(Web Novel) Betrayed in a Blessed World
|
(Work In Progress)
|
(Work In Progress) Werewolf Survival - A Dark Fantasy GameLit Interactive Adventure
|
***ABANDONED***It Was the Best of Slimes, It Was the Worst of Slimes
|
***DISAVOWED*** Not A Princess Story
|
*A Dwarf's Story*
|
*A Fool's Errand*
|
*DING* : A Dreamer's Game
|
*DISALLOWED* The Light and Ages Saga: Reference Books
|
*DISAVOWED* DemonAge
|
*DISAVOWED* Descendants: Tales of Half Gods
|
*DISAVOWED* Fireheart: Age of Shadows
|
*DISAVOWED* Gemini
|
*DISAVOWED* Masters of The Elements
|
*DISAVOWED* The Machine Saga Vol. 1 Ral'mus
|
*DISAVOWED* Twilight of the Gods
|
*Discontinued*
|
*Generation One**The Anti Magic Ritual**Arc 6*
|
*Insert Title That'Ll Hook You In Cause I Don'T Know What Title To Think Of*
|
*The Nephilim Chimeras**Generation One**Saga 4*
|
+1
|
- Hp
|
---
|
--Aegis--
|
--Blacksmith's Ire, Book 1 of the Vengeance of the Wind Trilogy--
|
-An Unusual VRMMO Experience-
|
-Lost-
|
-Scarlet Surge-
|
-The World Saga-
|
-World of Infinite Possibility-
|
... And My Skillet
|
...Excuse me, but how do you expect me to defeat the Demon Lord when I only know how to heal..?
|
.The Dark Stranger.
|
.Wip.
|
0 Damage Assassin
|
0.1.0
|
1 Vs Tthe World
|
1) DECK: Annoying Dreams
|
100 Days
|
100 Luck and the Dragon Tamer Skill!
|
100 Ways to Make Money in a Fantasy World
|
100 Words
|
1000 Lives Relived
|
1000-Hit KO
|
10k Years Silent Cultivation
|
110 Fanfiction
|
12 Hand Asura
|
12 Zodiac!!
|
13 Clans of Gods: Book One [The God of Void]
|
13 Dimensions
|
13 Seconds
|
13.Ai
|
139 Years to the End of the World
|
13th Soul- Book 1 The God Slayer
|
18 Purifying Magics
|
2 AM in Woodstock, New Hampshire
|
2 Worlds
|
2'n Aloysius
|
2.5 D adventure
|
200X300
|
2025
|
2040: Queen of Nowhere
|
2040: Reconnection
|
2100
|
2278
|
23 Doors
|
23 Pangbourne Place
|
2332: Fleeing the Arrakis
|
24
|
24 The Conspiracy
|
243 Wanderers
|
299 441 Yen
|
2nd Chance
|
2Nd Chance: The Beginning
|
3 Bastards and a Red Slipper Demon Queen
|
3 Hearts
|
3 Kingdoms
|
3.0.1
|
365 Days in Another World
|
3D/2D: I Got Sent to a Fantasy World and Turned into an Anime Character?!
|
40 Thousand Reasons
|
46 Year Old Syndrome
|
48 Hours
|
49 And One Hero.
|
5 Dragon Emperor
|
50 And Above
|
7 Desire 7 Death , a way you chose me
|
7 Dragons and Princess
|
7 Envoys of the ends
|
72 Hours
|
777
|
7th Chronicle: Utopian Road
|
8.29Mm
|
8th Deadly Sin
|
8th Sense
|
9 Circles of Hell
|
9 Dragon War God
|
9 Levels of Hell - GameLit
|
9 Lives
|
9001: A Dungeon Ship Odyssey
|
9001: The resurrection of the Dominion
|
99 Dungeons: The Beast Lord
|
999 Ways To Die In A Ruined World
|
:Re.re.Re: (Completed)
|
=
|
[ Entity ] : Reincarnated soul
|
[ Entity ] : tale of those kings
|
[ Magical Amputee]
|
[ The Administrator ]
|
[18+] A Little Sister'S All I Need | 我只需要我的妹妹
|
[Abandoned]
|
[Alternative Recode]
|
[ARC.] Survival Online
|
[Archive] Legend of the Nameless Hero
|
[Avalon]
|
[Backup Online]
|
[Book 1.0] -- Perth'S Accidental Superheroes
|
[Censored]
|
[Chronicles of Sevestia] Book 1: Rebellion
|
[Conquerors Of The Delve] [Abandoned]
|
[Cyborg] - In A World Of Magic
|
[CYOA] Mastrya
|
[Deprecated Story No Longer Being Worked On]
|
[Discontinued] After the Fall
|
[Discontinued] Armus : First Draft
|
[Discontinued]「Atelier;Magus」
|
[Don't Die!]
|
[Dragon child]
|
[DROPPED] City Dungeon Abyss
|
[DROPPED] I threw away the legendary cat ears
|
[Dropped] The Eighth Child
|
[Dropped] The Former Cultivator Who Now Plays VRMMORPG's
|
[Dropped] The Teacher and Disciple
|
[Dropped] Truck Driver Reincarnation
|
[Earth Reborn]
|
[Email Protected]
|
[English] Tanaka no sujiganeiri no monogatari (Hardcore Tale of Tanaka)
|
[First Draft, Moved] Of Astral and Umbral
|
[French] Les Pions de l'Equilibres
|
[German] Mand'alor The Undying
|
[German] Path of Evolution Johannes: The Shackled // ...
|
[German] RE:HUNDERT -Leben in einer anderen Welt-
|
[Guardian]
|
[Hiatus] City Dungeon Abyss
|
[HIATUS] Dragon Scythe Online
|
[hiatus] Dungeon Run
|
[Hiatus] God of Plants
|
[Hiatus] In my second life, I will continue being a virgin.
|
[Hiatus] Player: Level 0
|
[HIATUS] Re:Turn, The Legend of the 4 Swords
|
[HIATUS]A Beautiful Twilight
|
[Indonesian] Great world traveler
|
[Kancolle] Diary of an Admiral
|
[LitRPG] Kernstalion
|
[NaNoWriMo] A Simple Life of A Farmer: Farming 101
|
[NaNoWriMo] A Tower of Hats
|
[NaNoWriMo] Apocalypse Master
|
[NaNoWriMo] Don't label me!
|
[NaNoWriMo] I died and was resurrected... on Earth?!?!?!!
|
[NaNoWriMo] Masqueraider of Dofus: Incarnam
|
[NaNoWriMo] The Mortal God's Melancholy
|
[NaNoWriMo]Author's Note
|
[Nexus] - Chaos Deficiency
|
[On Break Need Some Fixing] Rebirth of Versatile Mage
|
[OUTDATED] Paths of the Chosen
|
[PORTUGUESE] Saint Seiya: Kagutsuchi, o cavaleiro de Fornalha.
|
[PORTUGUESE] The Rise of a New King of The World ?
|
[PUBLISHED] Substation Seven: Condemnation
|
[Re] Cultivating the Universe
|
[RE] System
|
[RETIRED] Gamer's Guide to Waking up as a Dinosaur
|
[Runist]
|
[Second Saga]
|
[Semi-Webtoon] Moments In Time
|
[Semi-Webtoon] Shifters
|
[Semi-Webtoon] Shifters [participant in the Royal Road Writathon challenge]
|
[Short] behind your smile | 你的笑容 (COMPLETED ✓)
|
[Spanish] Ciudad del Alquimista
|
[Spanish] Hibrido en un mundo magico
|
[Spanish] Odisea [Furry/Yiff]
|
[THTG] The Hand That Guides
|
[Trance Revival]
|
[Untitled]
|
[Webtoon] Prophecy Online : Odyssey of Potato
|
[What If] : To Love Ru
|
[WIP] ORBs, a LitRPG
|
[XVA] Fallen Zeal
|
A "boring" Game.
|
A "Living" Weapon Named Death
|
A "Typical" Dungeon Capture
|
A 3% Chance for Glory
|
A Ai`S Adventure In A Different World In Space
|
A android,a ghost ,a immortal,a necromancer and a council in a bar
|
A bad deal.
|
A Bag Of Bones
|
A Bard's Song: Lore
|
A Bard's Tale
|
A Battle of Eyes Against the Gods
|
A Battlefield of Swords and Flowers
|
A Beastmaster's Tale
|
A Beautiful Nightmare
|
A Beautiful Twilight
|
A Beginner's Guide to Napping, Sunbathing, and Slaughtering Your Prey
|
A Beginner's Guide to Otherworld Cult Management
|
A Beholder's Path
|
A Billion Players
|
A Binding Soul
|
A Bit of Everything
|
A Black Man Reborn in Jiang Hu!
|
A Blacksmith's Tale. A LitRPG Story
|
A Blade's Shadow
|
A Blank Tale
|
A Blazing Journey: A New Beginning
|
A blend of everything
|
A Blighted World
|
A Blind Descent
|
A Blond Ray of Sunshine
|
A Bloody Game
|
A Bloody Mess: An abnormal story
|
A Boku No Hero fiction
|
A book fanatic's Journey through a Fantasy World
|
A Book to Remember
|
A bored boy looking for reason
|
A Bored Goblin's Journey to Pass Time
|
A Bored Immortal
|
A Bored Immortal's Adventure with Reincarnation
|
A Bored Passerby With Some Cheats
|
A bored story (Hiatus)
|
A Boy's Simple Ambition
|
A Boy's Wish
|
A Brand New Day
|
A brave new, Scary world
|
A Breath of Fresh Air
|
A Bride for Seven Brothers
|
A Bride For Seven Brothers (Sample)
|
A Bride in Diyu
|
A Broken Doll and her lost Soul
|
A Broken Kingdom
|
A Broken World
|
A Broken World [Dropped Pending Rewrite]
|
A Broken World [Rewrite]
|
A Bunnerfly in the Desert - A Kammiverse Story
|
A Butler in a Noble House - a Fruitless Endeavor
|
A Bygone Era
|
A Canopy of Stars
|
A Caregiver's Last Lesson
|
A Castle and a Tomb
|
A Castle in a Teacup
|
A Cat Is Fine Too
|
A Celestial's Wrath
|
A Century Later
|
A chance
|
A Chance Again
|
A Chance To Become a Adonis
|
A Chance To Become An Adonis
|
A Change In The Same World
|
A Cheap, OP Brawler
|
A Cheap, OP Brawler (Currently on Hiatus)
|
A Cheat Cultivation Level
|
A cheat that allows me to build a city in another world ?!
|
A Child of Moon and Sun
|
A Chitinous Journey
|
A Chuunibyou's Life in Another World!
|
A City Stranded Cowboy's Robot Mercy Killing Business
|
A Civil Minotaur In An Uncivilized World
|
A Cliché Multiverse Story
|
A Cliché Reincarnation
|
A Clone of Arth
|
A Cockroach's guide to magic
|
A Coder's Guide To Magic
|
A Collection Of Ideas. True's Oneshots.
|
A Collection of Short Stories: Quiet Girl
|
A Collection of Tales
|
A Collection of the CRAZY STORYTELLER
|
A Collection of Thoughts
|
A Colonist's Woes - Warhammer Fantasy
|
A Compendium Of Realities
|
A Compendium of Useless Powers
|
A complicated man with a simple dream
|
A Comprehensive Guide for Alchemy
|
A Conflicted World Needs Our Help, So a Goddess Sent Us On Our Way
|
A Conqueror's Tale
|
A Conquest of the Stars: The Heart's Anguish
|
A Convenient Fiction
|
A Couple's Journey In Another World
|
A Cultivation Realm Dungeon
|
A Cultivation Story
|
A Cultivator in a Magic Filled World
|
A Cup of Moondust
|
A Curious Case of Mobs Extra
|
A curious cat's life in a new world
|
A Curious World
|
A Curse in the North
|
A Cursed Life.
|
A cute duckling in an ugly world
|
A Cute Woman and Her Clingy Husband
|
A D&D Gamer in Garweeze Wurld
|
A D-rank Adventurer's Bizarre Reincarnation
|
A D-rank Adventurer's Bizzare Reincarnation
|
A Daemon's Gamble
|
A Dance of Light and Shadow
|
A Dance Of Poison And Curses
|
A Dance of Wyverns
|
A Dark and Dangerous Place
|
A Dark Connection
|
A Dark God In A Darker Multiverse
|
A Dark God In An Otherwise Godless Multiverse
|
A Dark Prophecy of the Last Age: From One War Torn World to Another
|
A Dark Road
|
A Darkened Realm
|
A Dash'in Legacy
|
A Day With The Cross Dimensional Traveling Truck Driver
|
A Dead God's Wish
|
A Deathly Contract
|
A Degenerates Book for Survival
|
A Demon Between Worlds
|
A Demon Lord NEED HELP!
|
A Demon lord's dilemma
|
A Demon lord's dilemma(dead)
|
A Demon Lord's Reincarnation
|
A Demon Lord's Virtual [Magic Life]
|
A Demon Resides in My Phone
|
A Demon Within
|
A Demon's Gift
|
A Demon's Ordinary Survival Story
|
A Demon's Tail
|
A Demon, Probably
|
A Demonic Conquest
|
A Demons Evolution
|
A Demons Evolution (Hiatus)
|
A Deranged World
|
A Descendant To God
|
A Dessert of Dreams
|
A Destructive Incarnation
|
A Devil's Child
|
A Diary of Tressure
|
A Different Destination
|
A Different Kind of God
|
A Different Kind Of Hero
|
A Different kind of Hero (Marvel)
|
A Different Kind of Hero (Will Be Revised)
|
A Different Kind Of Journey
|
A different point of view
|
A Different World Where The Demons Are Good
|
A Disciple from Beginning, A Master to End
|
A Dissonance in Harmony
|
A Ditto's Tale
|
A Diver's Tale
|
A Dog with a Chair
|
A Dog's Loyalty
|
A Dose of Nonsense
|
A Draconic Insurgency
|
A Draconic Odyssey
|
A Dragon Among The Stars
|
A dragon familar
|
A Dragon Gnawing Its Tail
|
A Dragon Idol's Reincarnation Tale
|
A Dragon In human Skin
|
A Dragon in the System
|
A Dragon With Fur
|
A Dragon's Curiosity
|
A Dragon's Dungeon
|
A Dragon's Grimm Cultivation
|
A Dragon's Treasure: A Reincarnation Story
|
A Dragonoid's Tale
|
A Drastic Step
|
A Dream
|
A Dream Eternal
|
A Dream of Crows
|
A Dream to the Summit
|
A Dryad isn't just firewood
|
A Dryflame Child's Life (Rewriting)
|
A Dulled Blade
|
A Dumb Girl in a Cultivation World
|
A Dungeon Core
|
A dungeon core story: Magic with a hint of Science
|
A Dungeon Game
|
A Dungeon in Space
|
A Dungeon of Fate and Fae
|
A Dungeon Of Fire And Death ( english ) Eine MI des Feuers und Todes ( german )
|
A Dungeon Tested
|
A Dungeon's Journey
|
A Dungeon's life
|
A Dungeon's Republic
|
A Dungeons Quest
|
A Dying World [DROPPED]
|
A failure's hopeful journey.
|
A fairy tale for the nephilim
|
A Fantasy in Time
|
A Fantasy of Everglow
|
A far universe story
|
A Farmer's Strength
|
A Farmers Life For Me
|
A Fate Set in Stone (On Hold)
|
A Female Rogue's Adventure Through Two Worlds
|
A Female's Take on The World of Cultivation
|
A festering world
|
A Festival of Fools
|
A Fiery VRMMORPG adventure
|
A fine octet of legs
|
A Fire
|
A Fire Magician.
|
A Fish's Tale
|
A Flower in Death's Embrace
|
A Flower underneath a Willow
|
A Fly in Cultivation Universe
|
A Fool fooling around in another world
|
A Fool's Vagrancies
|
A Forbidden Contract
|
A Forced Hero
|
A Forest Dungeon
|
A Forgemaster Of Wayland
|
A forgotten ruler
|
A Forgotten Soul
|
A Forgotten Specter
|
A Forgotten Vampire
|
A Former Hero's Journey: I just want to live peacefully!
|
A Fourth Dimention Reality
|
A Fox at Heart
|
A Fox in the Woods
|
A Fox's System
|
A Fractal Divide
|
A Fractured Song
|
A Fragmented Mind
|
A Friendly Shadow
|
A Frozen Conquest!
|
A Future Destroyed - A Post-Modern Fantasy LitRPG
|
A Galactic Dictator's Adventures into a Magical World!
|
A Galaxy, Alive
|
A Game For Monsters
|
A Game Of Chess
|
A Game of Dancing Pieces
|
A Game of Hedrons
|
A Game of Life
|
A Game of Unknown Origins
|
A Game of Villains
|
A Gamer But I Also A Realist That Do Not Believe Anything That Not Disprove
|
A Gatored Community
|
A Gem To Be Remembered [bl]
|
A generic love story
|
A generic love story: disturbance
|
A generic love story: Transcendence
|
A genius of none
|
A Gentleman's Curse
|
A Gentleman's Curse: Arc 2
|
A Ghost in the House of Iron
|
A Ghost Life
|
A Ghoul's Legend
|
A Giant Among Dragons
|
A Girl and Her Fate
|
A Girl and her Goat
|
A Girl's, Unusual Existence
|
A Gladiator's New World [HIATUS]
|
A Glass Window
|
A Glimmer in the Dark
|
A Goblin's Blade (dropped)
|
A Goblin's Evolution
|
A Goblin's Tale
|
A God in a Xianxia world
|
A God In The Bay (Worm/Massive Crossover) (Worm Quest)
|
A God's Chosen
|
A god's crime against humanity
|
A God's Freedom
|
A God's Fun Time
|
A God's Game
|
A god's Perspective
|
A God's Pub
|
A God's Purpose
|
A Golem And Puppets Adventure
|
A Golem in a Cultivation World.
|
A Good Bargain [HIATUS]
|
A Good Man
|
A Good Night's Rest
|
A Grand Journey
|
A Gray and Grey world
|
A Guard's Dream
|
A guide to hero killing
|
A Guide To Immortality (discontinued)
|
A Gun in a Dungeon
|
A Gun is the Strongest Weapon in a Fantasy World!
|
A guy reincarnated as a sloth and is too lazy to be a protagonist
|
A guy reincarneted as a sloth and is too lazy to be a protagonist
|
A Guy, A Latte and Status Screen.
|
A Hand In Darkness
|
A Hand-Woven Universe
|
A Hard Game (Dropped)
|
A Healer's Gift, An Adventurer's Heart
|
A healthy mind in a healthy body
|
A Heart of Ice (hiatus)
|
A Herald for Spirits
|
A Hermit's Life for Me
|
A Hero Past the 25th
|
A Hero Past the 25th: Old Empire
|
A Hero Past the 25th: Paradise Lost
|
A Hero Returns
|
A Hero Returns (On Hiatus)
|
A Hero to Only One. (Completed)
|
A Hero turned Succubus's Tale
|
A Hero's Brother
|
A Hero's Common Sense
|
A Hero's Legacy
|
A Hero's New Beginning, Again...
|
A Hero's War
|
A Hidden Secret
|
A Hidden Vampire Class????
|
A Hidden World
|
A High God's Reincarnation
|
A Highest Rank in Another World!
|
A History Buff Brought to Another World
|
A Horcrux's Fate
|
A Hunt For Crows
|
A Hunt Upon Wings of Shadows
|
A Hunter's New Home
|
A Hunter's Wings [Rewrite]
|
A Jaded Life
|
A Jedi was on the Planet Alderaan.
|
A Jewel's Worth
|
A Job for a Wendigo
|
A Journey Away - Book One of The Eternal Flame
|
A Journey Into Mario World
|
A Journey of an ordinary girl in a fantasy world
|
A Journey of Black and Red
|
A Journey of Chaos and Glory
|
A Journey Of The Fated Conqueror Part 1: Mortal Realm
|
A Journey Through Frost and Snow
|
A Journey Through the Worlds.
|
A Journey To Remember
|
A journey to the beginning
|
A Journey With Gods and Monsters
|
A Jump Into Fantasy
|
A Just God's Angels
|
A Kid and His Slime
|
A Killer Reborn
|
A King of His Own
|
A King of Old
|
A King's Bargain (Legend of Tal #1)
|
A King's Regret - Ravenchild
|
A Kingdom of Power, of Courage, and of Wisdom
|
A Knight Of Humanity
|
A Knight's Promise
|
A Knight's Redo (Completed)
|
A Knight's Will
|
A Land Without Kings
|
A Lasting Fury By Replica1
|
A lazy king
|
A Lazy Programmer
|
A League Apart - Journeys to the Beacons
|
A Legend Reborn
|
A Legendary Tale: From rags to divinity!!!
|
A librarian
|
A life of excitement
|
A Life of Terror.
|
A Life Rewritten
|
A Life's Journey
|
A Life's Lie
|
A Lifetime Promise
|
A Little Bit OF A Silverlining HIATUS
|
A Little Bit Of Motivation
|
A little bit of Villainy
|
A little case of a supernatural affair
|
A little Kitty's journey though a random world
|
A Little Sister'S All I Need | 我只需要一個小妹妹
|
A Lone Automaton's Journey To Find Its Operator
|
A Lonely Dungeon
|
A Lonely Girl's Journey to Immortality
|
A Lonely Tree
|
A Loner's Calling
|
A Long Fall From Grace
|
A long slumber.
|
A loose Page
|
A Lord of Death
|
A Lost Man
|
A Lost Necromancer's Saga
|
A Lotus Of Death
|
A Love at Stake
|
A love so divine!
|
A love to kill!
|
A Lover Siblings in Royal Road!
|
A Madlad in a Magical Apocalypse
|
A Magic Sniper in Another World [Hiatus]
|
A magical fox Stole my body and gave me its
|
A Magical Life: Ink Swan
|
A Magus Among Cultivators
|
A Maiden's Frozen Heart
|
A Maiden's Strange Voyage
|
A Mailman as a Superhero
|
A Major in Necromancy
|
A Man and His Greatsword
|
A Man and His Gun
|
A Man and the Sea
|
A Man At Arms
|
A Man in the Gods' World
|
A Mao's Tale
|
A Martial Odyssey
|
A marvel rise
|
A Master, 5 Students, and Revenge [AM5SR]
|
A Master, 5 Students, and Revenge [AM5SR}
|
A Maze of Glass
|
A mean Demon Queen Kidnapped me!
|
A Meaningless Hero
|
A Mediocre Supreme Cultivator
|
A Melody of Fire and Lightning
|
A Merchants Tale
|
A Mere Fate of Mine
|
A Mermaid's Responsibility
|
A Meta-Human In Another World
|
A Metaverse Dungeon - Foodie's Enigma
|
A Mildly Odd Reality Breaker
|
A Modern Cultivator's Dilemma
|
A Modern Day Demon King
|
A Monarch of Fate
|
A Monarch's Quest
|
A Monster's Jaunt
|
A Most Unfortunate Summoning
|
A moth of winter - A Kammi Kettu fan story
|
A Mother's Bond Taken After Death
|
A Mouse in the Circuitry - A Kammi Kettu Story
|
A Music Prodigy
|
A Nanomachine Magical World (A LitRPG Adventure)
|
A Nation of Riflemen
|
A Naturalists Dungeon
|
A Necromancer's Village
|
A Needed New Start
|
A nerd in another world
|
A Nerd's Wet Dream Come True (Tossing an OC into DC Comics)
|
A Nerd's Wet Dream Come True (Tossing an OC into Dc Comics) V.2
|
A Nerd's Wet Dream Come True (Tossing an OC into Marvel)
|
A Nerd's Wet Dream Come True (Tossing an OC into Marvel) V2.
|
A Nerd's Wuxia Tales
|
A New Adventure
|
A New Beginning By Aerebes
|
A new Breath Online
|
A New Breed of Pirate
|
A New Breed of Pirate: A VRMMO Tale
|
A New Continent
|
A New Dawn
|
A New Dawn (Old Version)
|
A New Goddess
|
A New Human
|
A New King
|
A new leaf (Old version)
|
A new life
|
A New Life (zod119)
|
A new life in a new world.
|
A new life of a boy (working title)
|
A New Life Through The Eyes Of Kanto: An Autobiography
|
A New life with the choice of destruction or creation in a new world(hiatus)
|
A New Line Through The Lives Of Kanto
|
A New Loli Life On A Fantasy World!
|
A New Path
|
A New Path, Chosen freely
|
A New Shroom Life
|
A New Story
|
A new world
|
A new world a new Chance(DROPPED)
|
A New World To Call Home, As Sloths Representative
|
A New World: Eve
|
A New World? I'll Do What I Want!
|
A new zombie apocalypse
|
A ninja transported to another world
|
A Nobody Special
|
A normal man's journey
|
A Not Quite Parallel World Story
|
A Not So Dark Soveriegn's Rise
|
A Novel World
|
A Numbers Game
|
A Parallel Dream
|
A Path of Business: My Loyal and Lovely Husband
|
A Path Of Rage
|
A Path to Crown
|
A Path to Magic
|
A Pawn of Chaos in the Game of Fate
|
A Pawn of Chaos in the Game of Fate - Revision
|
A Pawn of Chaos in the Game of Fate - Rubble Rats
|
A Pawn of Chaos in the Game of Fate [Pre-edit]
|
A Petal Torn of Shapeless Thoughts
|
A Phoenix's life
|
A picture is worth a Chapter
|
A Pipe Dream
|
A Pirates life isn't always gold
|
A Place to Belong - A LitRPG Adventure
|
A Place To Send Chapters
|
A Place Without Wind
|
A Play ground for an Undead Lord
|
A Player in the Greenwood
|
A Playground For The Powerful
|
A Polite Society
|
A Power Manipulator's Multiversal Adventures
|
A Powerful Duke In Another world
|
A Practical Guardian
|
A Practical Guide to Sorcery
|
A Pre-Apocalyptic Rebrith
|
A Price In Memory
|
A Price In Memory (Aspect of the Beast Rewrite)
|
A Princess Melody
|
A Princess of Alfheim
|
A Princess, a Dragon, a Rogue and One Other Guy
|
A Profane Weapon's Wonderland Fantasy
|
A Professional Reader's Guide to Amateur Writing
|
A Promise
|
A Promise Marked by Fire
|
A Protector's Circumstance
|
A Protracted Game [Web Serial]
|
A Psychic's Scarlet Dream
|
A Psycho in a Ruined World
|
A Psycho in the Ruined World
|
A Psycho's Diary
|
A Puppeteer's Journey
|
A Queen of Ruins
|
A Quest for a Cure
|
A Quest for Existence
|
A quest to reveal the truth of humanity
|
A Question of Character (shelved)
|
A Questionable Persons Questionable Look At Life
|
A ragbag of stories, don't expect them to end.
|
A Random story of an Adventurer
|
A Rather Unfortunate Gun-Wizard
|
A Rational Zombie (Complete)
|
A Rats Life
|
A Raymond's Raven - (The Exploration of Magic in World War 1)
|
A Real Life
|
A Reaper's Tale
|
A Rebellion of The True Heir
|
A Reincarnates Story
|
a Reincarnation full of choices
|
A Religious Witch?! How Incredbile!
|
A Restart on Life
|
A Retired Vets New Life: An Apocalyptic Novel
|
A Robbery Of Goats
|
A Robin and A Crow
|
A Romance of Villains
|
A Rotten Soul
|
A rotten soul (short hiatus)
|
A rouges life in another world
|
A Royal Warrior
|
A Safe Place
|
A saga of Alviona, a girl who would be known as Crimson Queen
|
A Sage's Different World Logs
|
A Saviour's Endeavour
|
A Scientist And His Hi-Tech Laboratory Suddenly Transported In Another World
|
A Second Chance (Invasion Book #1): LitRPG Series
|
A second life
|
A Sehealian Chronicle
|
A Series of One Shots
|
A series of Short stories
|
A series of Transmigrated Misadventures.
|
A Serpentine Tale {Dropped}
|
A Servant of Justice
|
A Servant of The Empire
|
A Sh Ai El
|
A Shadow
|
A Shapeshifting ________!
|
A Shattered World
|
A Shifter's Journey
|
A Shifters Journey
|
A Short Story Collection
|
A Sick Twist of Fate
|
A Silvertongue's Tale
|
A simple book
|
A Simpler Reality ( Revised )
|
A Single Thought
|
A Siren's Call
|
A Sister'S All You Need | 如果有妹妹就好了
|
A Sith's Journey
|
A Skazka
|
A Skill Whore's Journey
|
A Skin-Changer's Tale
|
A sky as blue as ours
|
A Sky of Star and Strength
|
A Slave's Voice (Revision Pending)
|
A Slayer's Diary
|
A Sleepless Apocalypse
|
A Slice Of Life Of Broken Man
|
A slip into fantasy
|
A Slip Of The Force
|
A Small Town Called Cadaver
|
A Smidge of Magic
|
A Smile To Remember...
|
A Snail's Wisdom
|
A Snake's Life
|
A Snake's Rise
|
A Soldier Tale
|
A Soldier's Dream - Elementum Adamantinus Purifico
|
A Soldier's Fragmented Memoire
|
A Soldier's Life
|
A Solitary God In A Dark Multiverse
|
A Song Calls Them Home
|
A Song for the New Age
|
A Song of Goblins and Skeletons
|
A Sorcerer's Footsteps
|
A Soul Bound Dragon
|
A Soul's Dream
|
A Soul's New Home
|
A Soul's Wish
|
A Space Odd-yssey?
|
A Standard Superhero World
|
A Star for Every Soul
|
A Star is Born
|
A Step Behind Death
|
A Step into Madness (Dropped)
|
A Step-by-Step Guide to Conquering a Fantasy World
|
A Storm in the Fall
|
A Story about a Magic Book
|
A Story About a Vampire
|
A Story From June
|
A Story in Black and White
|
A story in which numerous people die
|
A Story less Told (The legend of Adrian Michael Greggarious, book 1)
|
A Story That You Wouldn't Want To Read +
|
A Story To Choice From (10 One Shots)
|
A story where the main character is too Op!
|
A Strand of Divine Sense
|
A strange soul
|
A Stranger in Sorcererstown
|
A Stranger in Sorcererstown (The Stranger Trails Saga)
|
A Struggle Through the Deadly
|
A Student's Journey through Magic and Mayhem
|
A Student...Like You
|
A Students Gate to Hell
|
A Study in Rain
|
A Succubus System? But I'm a Virgin!
|
A Sudden Cute Baby: My Awesome President Dad
|
A Super Robot Story
|
A Super Robot story.
|
A Superhuman Family In Another The World?
|
A Superior Being Will Always Rise ... Even If They're A Goblin
|
A Sword Master's Travels (1)
|
A Sword Spirit's Journey in the Myriad Realms
|
A Sword's Nakama
|
A System To Kill Monsters?! I Just Want A Date For Prom!
|
A Tactician's Mind
|
A Tail's Misfortune
|
A Tainted Promise
|
A Tale From Azaad
|
A Tale From Azad
|
A Tale of a Certain Lolicon
|
A tale of a girl and her shadow
|
A Tale of Casual OPness
|
A tale of Might and Magic
|
A tale of nonchalance and tomfoolery...
|
A Tale of Peril: Change
|
A Tale of Sorrow and Love: Book I
|
A tale of teleportation
|
A Tale of the Elements
|
A Tale of Twin Moons
|
A Tale of Two Heroes
|
A Tale of Two Sisters
|
A Tale of Two Worlds
|
A Tale of Vengeance
|
A Tale of Villainy
|
A Tale of Winter
|
A Tale To Tell
|
A Taste for the Finer Things
|
A Technomaniac in Another World
|
A Ten Pound Bag
|
A Ten Year Vacation Turned Me Into A 14 Year Old Kid
|
A terrible field trip
|
A Theft Of Stars
|
A Thief's Tale: The Road To Redemption
|
A Thief's Tale: The Road To Redemption v1.826
|
A Thiefs Tale
|
A Thousand Faces: The Villain's Journey
|
A Thousand Year Old
|
A Thousand Years Queen
|
A Thread of Fate
|
A Time for Leisure
|
A Tingle Later: A Different Kind of Hero Tale
|
A Tinker's Damn - Book 1 of Descendants of a Dead Earth
|
A Titan's Crusade
|
A Toaster Story
|
A Tomb of Dead Stories
|
A Topaz in the Rough
|
A Towel to Save your Life
|
A Trace of Heroism
|
A Tragedy for a Demon Lord
|
A Train Between Worlds
|
A Traumatized Girl's Quest for Home in a Fantasy Land
|
A Traveler's Legend: Leisurely Living My Life In A Normal World
|
A Traveler's Tale
|
A Travelling Mage's Almanac
|
A tree's simple life
|
A Tribe of Kassia
|
A Truck Driver's Tale
|
A True Queen's Life
|
A Twist that Lead to the Fall
|
A typical fantasy Journey
|
A Typical Love Story
|
A Tyrant: Unshackled
|
A ugly swan
|
A Universal Tale
|
A Vague and Indistinct Existence
|
A vampire life
|
A Vampire's Dilemma
|
A Vampire's Journey in a Fantasy World
|
A vampiric Blade Reforged
|
A Very Autistic Post-Apocalypse
|
A very strange rebirth
|
A villainess Reborn
|
A Viral Life
|
A Virtual Invasion
|
A virtual reality game according to a martial artist otaku
|
A Virus Life For Me
|
A Vixen's Blood
|
A Void Spirit's Slightly Psychotic Tale
|
A Vorrgistadt Shard - The Shattered Oracle
|
A VRMMORPG Adventure: The Legend of the Legendary Rogue!
|
A Wanderer's Story by Dms143
|
A Wandering Dude
|
A War Beyond Kings
|
A war for the ages
|
A War of Galaxies: The Things I've Seen
|
A War To End Them All
|
A Warlock From Elsewhere
|
A Warlock's Luck
|
A Warm Bed & A Hot Shower
|
A warm share of happiness
|
A Warrior's Love (BL)
|
A Way of Life
|
A Week to Infinity
|
A Weird Book #1
|
A Well Dressed Wolf
|
A Wheel Inside a Wheel
|
A Whisper Among the Stars
|
A Wicked Tale Of Witches, Wands, Booze, and Swagger
|
A Will and A Way
|
A Wish For Power
|
A Wish in the Night
|
A Wish Of Change
|
A Wish Upon The Stars
|
A Witch out of Time
|
A witcher cultivator.
|
A Wizard of the past
|
A Wizard's Birth: Awakening
|
A Wizard's Life In a New Earth
|
A Wizard's Sacrifice, Book Two of the Woern Saga
|
A Wizard's Soul
|
A Wolf among Dogs
|
A Wolf In Penrith - A Kammi Kettu Story
|
A Wolf's Journey
|
A Wolf's Way
|
A Wonderful Adventure in a Wonderful New World
|
A World Away
|
A World Beyond
|
A world born from ashes (undefined hiatus)
|
A World Forgotten
|
A World in Chaos
|
A World In Motion
|
A World of Many
|
A World of Monsters
|
A World of My Own
|
A World of Summoned Heroes
|
A World Reborn
|
A world travelers problem
|
A World Traveller
|
A World With My Destiny
|
A World With Nothing Normal
|
A World With or Without Aliens
|
A world with two moons
|
A World Without
|
A World without a System?!
|
A World Without a Tomorrow
|
A World Without Them
|
A World Worth Fighting For
|
A World Worth Protecting For
|
A Worldly Tale: Speechless
|
A Wrinkle in Reality
|
A writer's legend
|
A Yellow Dress Forgotten
|
A young girl is my master and I'm son of the demon king?
|
A Zombie's heart (BL)
|
A Zombie's heart (BL) - HIATUS
|
A(n) (Other)worldly Tale.
|
A-Live AI
|
A-Zero
|
A.I.
|
A.I. Actual Intelligence
|
A.R.K
|
Aarav - A journey with a Spirit in Another World
|
Aaron, A Shadow Monster
|
Aatrox, A God King in a Modern World.
|
Aavare
|
Abandon all hope by Darkmatter
|
Abandoned Card System
|
Abandoned: The Story About Ryu The Banished God
|
Abandoning All Hope
|
Abduction Chronicles: GENESIS
|
Aberrant
|
Aberrant: Unbound Soul
|
Abigail the Grimoire
|
Ability
|
Ability to make a kingdom? Let's make a fast food restaurant!
|
Abnormal
|
Abnormal 2
|
Abnormal Boy Enters A New World
|
Abnormal Days
|
Abnormal Tamer
|
Abominable King
|
Abomination
|
About a dangerous girl
|
Above All
|
Above All Shadows
|
Above and Below
|
Above Heavens I Stand
|
Above the Fog
|
Above the Heavens
|
Absalom's Fate (The Everlands Book 1)
|
Abscondere
|
Absolute Control
|
Absolute Divinity (JJBA)
|
Absolute Knowledge
|
Absolute Order
|
Absolute Power
|
Absolute Power of the Imagination
|
Absolute Shopping Addict
|
Absolute Supremacy
|
Absolute Trinity
|
Absolute Zero
|
Absolution
|
Absorbed
|
Absurd Mage in Another World
|
Abyss "tomb of the gods"
|
Abyss Core
|
Abyss System
|
Abyss: A gamelit adventure
|
Abyssal Fortress girl in another world
|
Abyssal King
|
Abyssal Road Trip
|
Abyssmal Downpour
|
Abyssus
|
Acacia Chronicle
|
Acadamia of Heroes
|
Academy of Heroes (The Murder of Innocence)
|
Academy Saint
|
Acadia: A LitRPG Adventure
|
Accidental Adoption
|
Accidental dungeon
|
Accidental God
|
Accidental Love Destined Betrayal
|
Accidental Merlin
|
Accidental Orc
|
Accidental summon
|
Accidental Time God
|
Accidentally Blessed by a Goddess Before Reincarnating
|
Accidential dungeon
|
Acclimation
|
Ace of all Trades
|
Ace of Demons
|
Aces From Hell
|
Achemist Dungeon
|
Acheron
|
Acolyte
|
Acolyte: The Emerald Gates
|
Acousat
|
Across the border
|
Across the Realms
|
Across the Realms [Dropped]
|
Action, Adventure, Videogame
|
Adam is the Protagonist
|
Adam's coin
|
Adam: The Archer
|
Adamant Doom
|
Adamantine Dragon in the Crystal World
|
Adamantine Heart
|
Adapt: The Scourge Wars Book 2
|
Addiction
|
Adelaide
|
Adeptaverse
|
Adeptaverse - Origins Of Altara
|
Adeptaverse - The Holy Calamity
|
Adermoor Cove Part 1: The Rainbow Beret
|
Admin Playground
|
Admin Playground - leave it be.
|
Admin Test
|
Adonis
|
Adonis:On
|
Adorne: (A LITRPG adventure)
|
Adorne: (A LITRPG adventure) (DROPPED)
|
Adrift
|
Adrift To Stranger Land
|
ADT - Another Dimension Travel
|
Advent
|
Advent of a New World!
|
Advent of an Assassin
|
Advent of the Apocalypse
|
Advent of the Apostles
|
Advent of the Ascended [Dropped]
|
Advent of the Immortal Dream
|
Advent Of The Median
|
Advent of the Skeleton King
|
Advent Steel
|
Advent: Red Mage
|
Adventure From A Bard's Perspective
|
Adventure In A Foreign World - Legacy of The Chosen One
|
Adventure of a system supported gamer
|
Adventure of Adventures
|
Adventure of Chance
|
Adventure of Lara
|
Adventure of Luke
|
Adventure of The Eternal Brothers
|
Adventure Online
|
Adventure Party: Forest Crypt Campaign
|
Adventure Quest: Guardians of The Night Sky
|
Adventure to the Stars
|
Adventure With A System
|
Adventure? Slime? Slimeventure? Yeah, something like that.
|
Adventured away
|
Adventurer
|
Adventurer - Sunrise Over Sunset
|
Adventurer Academy: Greyblood
|
Adventurer Hearth's Guide to Monster Taming
|
Adventures in a Shattered Worlds Beta
|
Adventures in amnesia
|
Adventures in Atalok
|
Adventures in Magic
|
Adventures in Mim
|
Adventures in Planus
|
Adventures in Red: Gunslinger's Follower
|
Adventures in the Pirate Continent
|
Adventures in Wonderland
|
Adventures of a Fake Monk
|
Adventures of A God!
|
Adventures of a Reluctant Pacifistic Monster
|
Adventures of a young Zuma
|
Adventures of Alex Blackwell
|
Adventures of an avid gamer
|
Adventures of an Old Dreamer
|
Adventures of Branden Balond
|
Adventures of Lord Genesis
|
Adventures of one dude with an afro
|
Adventures of Percy Jackson in the MCU
|
Adventures of Ragnos
|
Adventures of Shadow and Garb
|
Adventures of Stephen Silworth
|
Adventures of the Bearmon Trainer
|
Adventures of the Blasted Marksman [Rewrite]
|
Adventures of the First Being
|
Adventures of the Goldthirst Company
|
Adventures of the moon
|
Adventures Of Truck-san
|
Adventures of Vee
|
Adventures of Zik Sev
|
Adventures on Patriam: Wolves and Men
|
Adventures on Terra: Beginning
|
Adventures With a Reincarnated Bush
|
Adventuring In A Unique Xianxia Universe
|
Adventuring in Another World
|
Adversary
|
Advice for Authors
|
Aefell Online
|
Aegis
|
Aegis Of The Gods
|
Aelin (title may change)
|
Aelios Online
|
Aenthar
|
AEO Alt Earth Online
|
Aeon Chronicles Online
|
Aeon Chronicles: The Frozen Calamity
|
Aeon Genesis: The Lord of Servants
|
Aeon Genesis: The Sin of Innocence
|
Aeonica
|
Aerid
|
Aerid: Tales Of The Academy
|
Aeromancer
|
Aeroth: The Arrival of the Beasts
|
Aesthetic of a Female Rogue
|
Aestia Valley
|
Aestral Online
|
Aeterna
|
Aeterna Saga, Volume 1: Walking With Giants
|
Aeternalis
|
Aether
|
Aether Academy
|
Aether Dragon
|
Aether Gate Online: Slayer (A LitRPG Saga)
|
Aether Hex and the shards of the demon king.
|
Aether Knight
|
Aether Online
|
Aether Online Archive
|
Aetheral Space
|
Aetherial Adventures
|
Aethernea
|
Aetherworld
|
Aevitas — I am not an NPC [R]
|
Affairs of the Soul
|
Affinity
|
After All
|
After Apocalypse: Silver Wind
|
After Days Chronicles: A Cabin By A Lake And The Things Beyond.
|
After Death
|
After death?
|
After Earth Online: The Iron Warlock
|
After Eons
|
After I Lost to the Demon King
|
After Kreation: A Widower's Tale
|
After Life
|
After Life?
|
After Megiddo
|
After Megiddo: Hell's Pursuit
|
After Megiddo: The Book of Gideon
|
After Megiddo: Underrealm
|
After Moses
|
After the Fall and Other Stories
|
After the Fall. (Book 1 of the Shardfall Saga)
|
After the Game Over
|
After the Long Burn
|
After The Mountains Are Flattened
|
After the universe exploded, I became a Dungeon Master.
|
After Worlds End
|
After-Life
|
Afterdoom | The Post-Postapocalypse
|
Afterdoom | The Post-Postapocalypse (Complete~)
|
Afterlife
|
Afterlife - Next World's Auction House
|
Afterlife Hospital
|
Afterlife Industries: The Devil's Day Job
|
Afterlife Online
|
Afterlife Online: Reboot
|
Afterlife: A Gamelit Tower Story
|
Aftershocks
|
AfterWorld
|
Again
|
Again [On hold]
|
Again and again
|
Again from Scratch
|
Again?!!
|
Against all the Odds(hiatus)
|
Against My Fate
|
Against My Will
|
Against the Abyss
|
Against The Elements
|
Against the Heaven's Will
|
Against the heavens.
|
Against the heavens. *Hiatus for trial*
|
Against the heavens. *Rework in release.*
|
Against the heavens. *Temporary Hiatus*
|
Against the Nine Great Heavens
|
Against the Sky
|
Against the World. Chronicles of melancholy
|
Againts all the worlds
|
Agartha (hiatus)
|
Age Is Just a Number.
|
Age of Aggression
|
Age of Avarice
|
Age of Champions
|
Age of Change
|
Age of Charon
|
Age of Cultivation Online
|
Age of Destruction *dropped*
|
Age of Divinity - Unleashed
|
Age of Gods
|
Age of Gods - A VRMMO Story [Dropped For Now]
|
Age of Gods Online
|
Age of Heroes
|
Age of Heroes: Novus Gaia
|
Age of Immortal
|
Age of Legends
|
Age of Others
|
Age of Regression
|
Age of Revolution
|
Age of Swordsmen
|
Age of Swordsmen Online
|
Age of Teras: Monster Evolution
|
Age of the Dungeon Hunters
|
Age of Victoria
|
Ageless Aneurin
|
Agenda of the Villainess
|
Agent Lightning: Operation Angel Arms
|
Agent of the Alternates
|
Agent of the Realm?
|
Agents of Dawn
|
Agents of MAGE
|
Agents of Stigma
|
Agents of the Lord
|
Ages Online
|
Aggro Healer
|
Aghori
|
Agnes of Raegma
|
AGON: Trail by Champion
|
Agordos
|
Agorɔ
|
Agros de Mortis
|
Ahead of the Patch
|
Ahh so it's another dungeon story with a long name
|
AI Dungeon
|
AI Immortal God Soul
|
AI's Champion
|
AI: Revolution
|
Aim and Fire
|
Ain't A Hero
|
Ain't no Rest for the Wicked
|
Aincrad Realized
|
Aino and Eien
|
AinSlay
|
Airant
|
Airbound
|
Airi
|
Airi in a Thousand Worlds
|
Airium - Beta key
|
Aivuez: The One Being Brought to Lullaby
|
Aka
|
Akashic
|
AkaTsuki: Book One [The Heart of A Samurai]
|
Akhand : The Demon Emperor
|
Akif Kas - Champion of the Arena
|
Akuma Karu
|
Akuma no seifuku no fukushū?
|
Alamat (Legend)
|
Alaric Castle
|
ALARIC CASTLE: Becoming the Best Boss Level
|
Alaska 66 MYA (A Grant Foreman Adventure)
|
Albert's Summer
|
Albion Live
|
Alcaim Saga
|
Alceria
|
Alctuz Arena
|
Aldemoor
|
Aldenia: The Lost
|
Aldernoh
|
Alea Ludo
|
Aleri The Return
|
Alex Brim, Hero for Hire
|
Alexander Nightmare
|
Alexander's Deviant Vanguard
|
Alexis Longbottom and the New Age of Magic (Harry Potter AU)
|
Alfarome: Volper
|
Alfegenia-Inline
|
Alfheimr Renaissance
|
Alfirima Fea
|
Aliad - Tale of Zed [Dropped]
|
Aliad [Dropped]
|
Alice
|
Alice Devil Gift
|
Alice In Madness
|
Alice in Magic Land
|
Alice in Magic Land [UNREVISED]
|
Alice The Roaming Dungeon
|
Alice's Saga of Fire and Blood
|
Alice: Conquering Nightmare
|
Alien Abduction: A LitRPG
|
Alien Me
|
Alien Witch
|
ALIEN: Otherworld
|
Alien: Tribulation
|
Aliens in a fantasy world (AvP fanfic)
|
Aliens vs The Elvish Empire
|
Aliens! Tech! War! OH YES!!
|
Alistair's Great and Powerful Startup Dungeon
|
Alistair's Legacy
|
Alistair's Legacy (Currently under rewrite)
|
Alive
|
Alive ?
|
Alive, once again
|
Alive?
|
All
|
All Alone with You
|
All Because of a Serum
|
All Because of a Serum: Batch 1
|
All Days Shall Be Numbered ; A LitRPG
|
All Encompassing
|
All In One
|
All In One Anime
|
All into Agility
|
All Mine
|
All of The Angels
|
All Out of Time
|
All Songs: A Hero Past the 25th
|
All Stats Random
|
All systems rise to power.
|
All Things Must End
|
All Time Greatest Genius
|
All Trades Book 1: Master of None
|
All World Online
|
All's Fair in Love and Demons
|
All's Fair In Love&War
|
All-Powerful
|
All-seeing
|
Alland
|
Allocation
|
Alluring Smile (Yāoráo De Wéixiào)
|
Almagear
|
Almagear (V2)
|
Almavé
|
Almighty Dung
|
Almighty Dung [Dropped]
|
Almighty Hunter
|
Almighty System
|
Almisha's Journey
|
Almost Grimm
|
Alomiriya
|
Alone
|
Alone at my Destination- a Record of Climbing the Unending Tower
|
Alone No More
|
Along for the Ride
|
Alpha
|
Alpha - Book 1 in the Jaro Trilogy
|
Alpha Armageddon
|
Alpha Physics - Post Apocalyptic
|
Alpha Physics - Post Apocalyptic LitRPG
|
Alpha Squad - Vecto: Vengeance
|
Alpha: Amaryllis
|
Alphas & Omegas [Dropped]
|
Alt Atelier
|
Alter Online: Oathkeeper
|
Alter Tactics
|
Alter's Aburd Escapades!
|
Alter: Eclipse| The Chronicles of Gacaea | Book 1
|
Alteratio
|
Alteration
|
Alterea: The JoaT
|
Altered Realms Book 1: Inauguration
|
Altered Realms: Ascension [completed] - Book 1 - A LitRPG series
|
Altered Realms: Book 2 - Uprising - A LitRPG series
|
Altered Tales
|
Alterlife
|
Alterlife II
|
Alternate (Naruto FanFic)
|
Alternate 2020
|
Alternate Dreams
|
Alternate Earth Alternate timeline (DC)
|
Alternate Eyes
|
Alternate World Online
|
Alternative Berseria The X (アルタナティブ・べうセリア・ザ・クロス)
|
Alternative Reality Vol. 1
|
Alternative: To Love–Ru
|
Altrea: New sights from another world
|
Alviona (undergoing Rewrite).
|
Always and Forever
|
Always Name Your Tools
|
Alyx: the shifters tail
|
Alzholme
|
Am I a capture target in a otome game?
|
Am I a Goddess now?
|
Am i a goddess? A devil? No i am a lizard
|
Am I a goddess? A devil? No, I am a lizard
|
Am i spoiled?
|
Am I The Creator Or The Destroyer?
|
Am I The Only One Who Is Not Forced to Migrate Across Worlds....?
|
Amalgam System
|
Amalus
|
Aman
|
Amaron Online
|
Amazing Cleavage: The Adventures of a Battle Axe
|
Ambassadors to another world
|
Amber
|
Amber Silverblood
|
Amber Silverblood: Silverpack
|
Amber the Goddess of Time
|
Ambidextrous
|
Ambiguous
|
Ambition
|
Ambition [Indefinite Hiatus]
|
Ambitions of an Immortal
|
Ambot sa langaw pilay idad sa ok-ok!
|
Ambush (DarkForce: A GameLit Saga - Book 1)
|
Amending of the 'Evil' Pair.
|
America In Another World
|
America's Knight
|
Amethyst Phoenix
|
Amidst the Final Sky
|
Amie, Android
|
Amnesiac
|
Among Demons and Gods
|
Among Giants
|
Among Monsters and Men
|
Among the Dead
|
Among The Stars
|
Among the tear soaked flowers
|
Amongst The Sky
|
Amongst the Stars
|
Amulet of Infinity
|
Amusement Park
|
An 'Ordinary' Adventure
|
An A.I Is Such A Cheat In The Martial World!
|
An Abnormal Kobold
|
An Above Average Girl In A Fantasy World
|
An Academy for Villains
|
An Advance in Time
|
An adventure begins
|
An Adventure Beyond Greatness!
|
An adventurers tale
|
An Afterlife Odyssey
|
An Age of Fire and Blood - Volume 1: Unravel
|
An AI in Eden
|
An Aircraft Carrier in a Fantasy World
|
An Alien in Wonderland
|
An Animal in Sheep's Clothing
|
An Anime Weeaboo in a Different World [Hiatus]
|
An Anomaly's Life Inside A Galge is Seriously too harsh for me!
|
An Anthology
|
An Apex Supreme Master Running A Library Filled With System
|
An Apprentice's Adventure
|
An Aquila lost within an Oriental Land of Illusions
|
An arachnids way to Niflheim [HIATUS]
|
An Argonaut's Odyssey
|
An Aria of Fire and Blood - Volume 1 - Kismet
|
An Artificer's Ambition
|
An Atomic Choice (A Working Title)
|
An Atypical dungeon
|
An author's massacre; the sudden appearance of the world, and its immediate cry
|
An author's new view
|
An average adventurer.
|
An Average American in A High-school Academy Anime
|
An Average Joe Is the MC
|
An Average Zombie's Path of Evolution
|
An Edgy Tale Of An Edgy Teen
|
An Egotistical Heretic's Reincarnation Doctrine
|
An Eldritch Tale: the Archwizard's Tome
|
An Elven Druid's First Adventure
|
An Empire of Fire and Magic (The Chronicles of Pavel Maveth - Book Two)
|
An Empire of Shadows
|
An Empire Reborn (A Rebirth of Empire Series: Book 1)
|
An Empire Reborn (A Rebirth of Empire: Book 1)
|
An Empires Rising
|
An Enchanter's Tale
|
An Ent-Like Existence
|
An Eternity Gone By, To Learn To Live
|
An Everyday Journey
|
An Evil Hero
|
An Evil Justice
|
An Excuse for Space Battles
|
An Exile's Journey
|
An Exploration of Vulnerabilities
|
An Extra-Ordinary Story about Ordinary People
|
An Immortal Tale
|
An Immortals' Interaction with Modern Technology.
|
An Inconvenient Flame
|
An Indomitable's Odyssey
|
An innocent storm
|
An Interesting Journey
|
An Introduction to Being a Goddess
|
An islander's Meta-journey
|
An Minecraft Adventure
|
An NPC Challenges the Dark Lord(LN)
|
An NPC's Path: The Dead Rogue by Pavel Kornev
|
An Ode to Swordsmen
|
An Ode to the Birds
|
An Old Cultivation Record
|
An Old Man's Journey
|
An Old Man's Journey Vol 1 & 2
|
An old mans tale!
|
An Old Villian's Tale
|
An Omnibus of Heroes
|
An ordinary novel but every 10,000 words the audience kills the least interesting character
|
An Original Transformation
|
An Otherworldly Smile
|
An Otherworldly Tale
|
An Otherworldly Tale: A New Dimension
|
An Otherworldly Tale: The Apocalypse/A School Saga
|
An Otherworldly Tale: The Girl
|
An Otherworldly Tale: The Guild Moroides
|
An Otherworldly Tale: The Story Of Swords. The Ark Arc.
|
An overly OP MC in another world.
|
An Un-Ideal Eternity
|
An Unbound Soul
|
An Uncertain Duality
|
An undead's adventure
|
An Undying Coward in the Apocalypse
|
An Unexpected Adventure
|
An Unfamiliar Summon
|
An Unhinged Author
|
An Unidentifiable being even by God enters a fantasy world
|
An Unknown World
|
An Unlikely Haven
|
An Unthinkable Life From The Last Eternity
|
An untold tale
|
An Unusual Town
|
An unwelcomed and unwilling hero
|
An Upgraded Soul
|
Anachronism
|
Analytic System in Another World
|
Analyze, Create, Control In Another World
|
Anaraknakrium: The Cursid
|
Anarchy
|
Anarchy in a Deranged World
|
Anarchy's Dungeon
|
Anathema of the Eldritch
|
Anathum: Quest for the End
|
Anax
|
Ancestor, Wake Up! (Xianxia novel)
|
Ancestral World: Memorial Clouds
|
Ancestry: The 1/64 Orc, The Quest and The Status Screen.
|
Anchore
|
Anchore (Re-Write in Progress)
|
Anchored
|
Anchorkin
|
Anchorkin [Rerwiting]
|
Ancient Adventurer Return
|
Ancient Array Master
|
Ancient Blood
|
Ancient Blood Mage
|
Ancient Cultivator in Modern World
|
Ancient Dragon of Chaos [Spanish]
|
Ancient Earth
|
Ancient Fangs: Birth
|
Ancient Fangs: HOUSE AMULIUS (Book 2)
|
Ancient Mana Dungeon Core.
|
Ancient Return
|
Ancient Ruler [ XIANXIA ]
|
Ancient Sins
|
Ancient Sovereign
|
Ancient World
|
Ancientblood
|
Ancients
|
And Dungeon Makes Three
|
And far was the walk.
|
And Justice For One
|
And So We Leisurely Walk
|
And the world breaks
|
And then I made my own world
|
And Then You Left
|
And Thus, We Hoped
|
And You Thought Your World Was Harsh!
|
Andraste
|
Andraste's Chevalier
|
Andrea's Tale
|
Andromeda's Tears
|
Andur's Oneshot collection
|
Anemoia
|
Angel and Wolf: Chronicles
|
Angel and Wolf: The Fury
|
Angel of Death
|
Angel's Ascension
|
Angel's Dirge
|
Angel's Ladder
|
Angel's Redemption (BL)
|
Angel's Song: Requiem of the Dreams
|
Angelborn
|
Angelic adventures
|
Angelic Knight Of The Mighty Zealot
|
Angelic Quest
|
Angelica the Techno Ghoul
|
Angels Without Wings
|
Angry Dungeon
|
Angry Moon
|
Anilink
|
Anima
|
Animal Lord
|
Animated
|
Animated World: Drawn In
|
Anime Apocalypse
|
Anime Clichés 101
|
Anime Dungeon
|
Anime Girls From Another World
|
Anime of You: Traveling to Other Worlds
|
Anime powers in the Naruto world
|
Anime wheel of fortune
|
Anime World?
|
Anime Worlds System
|
AnimeCon Harem
|
Animus
|
Animus Smith
|
Animus Storm
|
Anna'dalia
|
Annals of the Snow Prince
|
Annihilation System
|
Annihilation's Impact
|
Anno
|
ANNO DOMINI ~Allium~
|
ANNO DOMINI ~Allium~ [Beta version]
|
Anno Iudicio
|
Annotated By Sins, Magic Academy
|
Annwyn Online
|
Anoikis
|
Anointed in Blood
|
Anomalous
|
Anomalous: A Contemporary Reality-Bending Adventure
|
Anomaly
|
ANOMALY ; Lost souls (dropped)
|
Anon: Goddess of Anonymity
|
Anonymous Demonic Angel
|
Another Apocalypse Story
|
Another Chance
|
Another Chance (Dropped)
|
Another Chance (Hiatus Indefinitely)
|
Another Chance in Life: I am Alive Again
|
Another Day
|
Another Day, Another Quest
|
Another Dungeon Report
|
Another End
|
Another Failure
|
Another Fantasy (Canceled)
|
Another hero Tale: Nephilim
|
Another Isekai
|
Another Isekai Story
|
Another Isekai Story!
|
Another life (Loks123)
|
Another life another chance
|
Another Life as a Bastard Pro Player
|
Another Me, But Cuter
|
Another Naruto Fanfic (Not For Fun)
|
Another Novel with OP MC
|
Another practice
|
Another Regurgitated Piece of Garbage
|
Another Reincarnation
|
Another Summoned Fantasy
|
Another Terror Infinity Fan Fiction
|
Another TI Fan Fiction
|
Another Vampire Story
|
Another World
|
Another World (Straightforward title, aye?)
|
Another World and I'm still rich?
|
Another World Online
|
Another World Priest
|
Another World Trucker
|
Another world with the Bleach System
|
Another World with the Omni System
|
Another World With The Skyrim System!
|
Another World's Devil-Queen
|
Another World's Hero
|
Another World's Homunculus
|
Another World's Trespasser
|
Another World: Scientist
|
Another World? Never Saw This Coming
|
Another world? Some weird magic? Sure.
|
Another You
|
AnotherWorld (hiatus)
|
Ant in Magic World.
|
Ant King
|
Ant Lord
|
Ant Lord: Monsters in the Fog
|
Ant Tensei (Original) and (Redux)
|
Antagonist
|
Antagonist Rewind
|
Antagonist's Sidekick Becomes the Hero!
|
Ante Portas
|
Anti-Hero: Journey of Fear
|
AntiGod
|
Antithetic: Spire of Wonder
|
Antlin's Prophecy
|
Antomea's Chronicle - Nina
|
Anxiety and the Beginning
|
Anya
|
Anyhorr
|
Aoi
|
Aoi - Part 1
|
Apathetic Hero (working title)
|
Apathetic Transition
|
Apathy
|
Apex Code
|
Apex Code [REWRITE]
|
Apex Legend in Another World [Litrpg/Dungeons]
|
Apex of Creation
|
Apex Predator
|
Apocalypse
|
Apocalypse 2020: Look to the Skies
|
Apocalypse : A New Dawn
|
Apocalypse : Judgement's Day [Rewrite]
|
Apocalypse Arcana - The Devil
|
Apocalypse at Mighty Max
|
Apocalypse Born
|
Apocalypse Boy
|
Apocalypse Enchanter
|
Apocalypse ending world
|
Apocalypse Evolution
|
Apocalypse Express
|
Apocalypse Hero
|
Apocalypse Hero - (Deletes July 1st)
|
Apocalypse in Russian style
|
Apocalypse Man
|
Apocalypse Now
|
Apocalypse Now (Hiatus)
|
Apocalypse Now: Under Contract
|
Apocalypse on Endless Earths: Apocalypse How? A LITRPG Adventure
|
Apocalypse Override: Zombieman
|
Apocalypse Please(?)
|
Apocalypse Rebirth
|
Apocalypse redone
|
Apocalypse Remnant
|
Apocalypse Remnant`
|
Apocalypse Respawn
|
Apocalypse Simulator
|
Apocalypse Start
|
Apocalypse Step
|
Apocalypse Ted!
|
Apocalypse The Fantasy
|
Apocalypse war
|
Apocalypse War: Survive. Die & Restart
|
Apocalypse War: Survive. Die. Restart
|
Apocalypse War: Survive. Die. Restart (expired version)
|
Apocalypse War: Survive. Die. Restart (OLD version)
|
Apocalypse War: Survive. Die. Restart (Reborn/Seconde chance - litrpg)
|
Apocalypse War: The Return of the Last Demon Slayer
|
Apocalypse Wishes
|
Apocalypse Wow
|
Apocalypse, Sounds Like Fun
|
Apocalypse: Generic System
|
Apocalypse?
|
Apocalypse? No, it is heaven!
|
Apocalypse? Paradise.
|
Apocalypse?it was my snack
|
Apocalyptic Evolution
|
Apocalyptic Paradise
|
Apocalyptic Survival- How to survive the Apocalypse -
|
Apocalyptic Trifecta
|
Apocalyptic World, Cheat
|
Apocalyptica: Vector's Edge
|
Apocalyspe ending world
|
Apoch's Twilight
|
Apocrypha of The Dead
|
Apollyon, The God of Chaos.
|
Apology of a Cold Heart
|
Apostate Konstantin
|
Apostle of Sin
|
Apotheosis - The Dungeon of Kess
|
Apotheosis - The Man Clad in Black
|
Appetite! [BL]
|
Appetizing Magic
|
Appless
|
Appolon
|
Apprentice of the Void
|
Approaching Ascension (Book 1)
|
Approaching Fate
|
Aqua Requiem Bloodlines
|
Aquaria
|
Ar'Kendrithyst
|
Arachnid Kid?Boy?Teen?
|
Arain
|
Arashia: A LitRPG story
|
Aratana hajimari (VRMMO)
|
Arawulf, the First Daughter
|
Arbiter of Power (Canceled and currently redone as 'Re:' version.)
|
Arborea
|
Arc a New born titan [suspended]
|
ARC. Survival Online
|
Arcade Warfare in Another World
|
Arcadia
|
Arcadia's Ignoble Knight
|
Arcadia's Reach
|
Arcadias Moon.
|
Arcadis Park
|
Arcana
|
Arcana: The Rebel King
|
Arcane
|
Arcane Army
|
Arcane Cycle
|
Arcane Engineer - The Awakened Dungeon
|
Arcane Engines: Alchemist's Scheme
|
Arcane Evolution
|
Arcane God Marcus
|
Arcane Power
|
Arcane Regeneration
|
Arcane Survivalist
|
Arcane Transmogrification (Book Two of the Pentacle Series)
|
Arcane Wonders
|
Arcane's Heart
|
Arcanist
|
Arcanist Warlord
|
Arcflame, the strongest tree-growing dragon
|
Arch
|
Arch Magus, The Wich Hunter
|
Arch, Inc. - Secret Origins
|
Arch-Mage? Arch-Warrior? Why Not Both?
|
Archage
|
Archaic Avalon
|
Archaic Princess
|
Archaic Records
|
Archaic Transmogrification (Book Two of the Pentacle Series)
|
Archangel
|
Archangel: Angels versus Angels
|
Archangel: Breaking Orbit
|
Archillies Duane : The World Traveller
|
Arching Choices
|
Arching Choices 1.2
|
Architect of Dominion (The Darius Kane Chronicle)
|
Archive - shapeshifters boredom
|
Archive of James: Origins.
|
Archmage Awakening: a Hunter Becomes a Mage
|
Archmage Father
|
Archmage Paladin
|
ArchMagus
|
Archon
|
Archonlight System Genesis
|
Archwizard's Tales: Book One
|
Arclight Online
|
Arduous New World
|
Are you a Lucker? (Luck based LitRPG)
|
Are You For Real!?
|
Are you worthy to Join my party
|
Area 51
|
Arena Earth
|
Ares
|
Ares' Witch
|
Argent Dawn (DROPPED)
|
Ari
|
Ari-os
|
Aria - The Pulsar Chronicles
|
Aria of Memory
|
Aria of the Fallen: Adventure in a Foreign System
|
Aria of the Sun and Moon
|
ARIA Online
|
Aria Wanderlust
|
Ariair Online
|
Arianna's Wish
|
Aries
|
Aris Cretu
|
Arkandia
|
Arkhay (Writers block on this story..Sorry guys. might never add more)
|
Arkund - Terror in the streets
|
Arlec
|
Armageddon Online - Escape
|
Armageddon: A Biography of a Forgotten History
|
Armageddon: A New World
|
Armbuster
|
Armor Corps
|
Armor of Justy (AoJ)
|
Armored
|
Armored Prayers
|
Armorling wants to be a king
|
ArmourXDemons
|
ArmS: The Last Human [dropped]
|
Army of one
|
Army Of One (Pokemon Fanfic)
|
Army of the Fallen
|
Arnar the Dungeon
|
Arowne'S Rebirth
|
Arpeligo
|
Arrested Alterings: A Genetic Detective's Hunt for Answers
|
Arrogance is justice!?
|
Arrogance: Lost reports
|
Arrogant Master In The City
|
Arrogant Young Master Template A Variation 4
|
Ars
|
Ars Alogia
|
Ars Arcana
|
Ars Remnants
|
Ars Utopia: A Fantasy Dystopia Story
|
Ars: The World Beyond The Walls
|
Art of Alchemy
|
Art of Mortality
|
Art of Poison
|
Art of War
|
Art Sword Online | アートソード・オンライン
|
Artanis Road
|
Artemis The Celestial Beast(Hiatus)
|
Artfin, Power Money and Woman [Dropped]
|
Arthron ~It seems I become a newbie god~
|
Arthropod Online
|
Arthur
|
Arthur "The successor of the god of time"
|
Arthur and the Mystery of Reincarnation
|
Arthur ReD
|
Arthur...but the draft
|
Artifice: Iysinfyr
|
Artifice: Tools of the Gods
|
Artificer
|
Artificial Biological Runic intelligence
|
Artificial Devastation
|
Artificial Fantasy
|
Artificial Jelly
|
Artificial Light
|
Artificial Mind
|
Artificial Seed
|
Artificial Selection
|
Artificial Selection: A Near Future Thought Experiment
|
Artificial War
|
Artificial Yuusha
|
Artisan
|
Arts Master
|
Arum: Reconquering the Dungeon World
|
Arun Online [Dropped]
|
Aruna
|
Arx Speculo
|
Arzhel's Magic Tavern
|
As a Dungeon
|
As an Isekai fanatic in another world : The chronicals of Mikhail and Ernesto
|
As Crônicas dos Últimos Leanfis - Furor da Magia
|
As Lightning Falls from Heaven
|
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon?
|
As Long As It'S Interesting, Isn'T It Fine To Live As A Dungeon? (Hiatus)
|
As the Godking Wills
|
As The World Catches Fire
|
As The World Spins
|
Ascend Online
|
Ascend to Be GOD
|
Ascendance
|
Ascendance: A Tower Story
|
Ascendance: Rebirth of the Unknown Gamer
|
Ascendancy
|
Ascendant Legacy
|
Ascendant of Air
|
Ascendant Online: A LitRPG
|
Ascendant: Online | Crash Through
|
Ascendant: Online | Witness the Beginning
|
Ascended
|
Ascended Dark Sovereign
|
Ascenders Rift
|
Ascending
|
Ascending Hero
|
Ascending The Heavens
|
Ascending Trinity
|
Ascension
|
Ascension Alphas
|
Ascension Core: A Cyberpunk Story
|
Ascension From Nothing
|
Ascension of a Reborn Woman
|
Ascension Of Moba Gamer
|
Ascension of Shura
|
Ascension of Singularity
|
Ascension of the Evil God
|
Ascension of the Godly Assassin
|
Ascension of the Strongest
|
Ascension Online
|
Ascension Rebirth [Dropped]
|
Ascension To Brutality
|
Ascension VR
|
Ascension: The Coming Storm
|
Ascension: The Helm of Lentha
|
Ascent
|
Ascent [Discontinued]
|
Ascent of The Enchanter
|
Asgard's First Elemental Necromancer
|
Ash
|
Ash Burst
|
Ash. The Legends of the Nameless World. Progression Gamelit Story
|
Ashen Essence
|
Ashen Ghost
|
Ashen Lord
|
Ashes
|
Ashes *Hiatus*
|
Ashes and Cinders
|
Ashes dungeon
|
Ashes of Creation
|
Ashes of Empires
|
Ashes of Eternity
|
Ashes of Gods
|
Ashes of Gods: Return of the Blade Emperor
|
Ashes of the Arctic
|
Ashes of the New World Book 1: The Light Burns the Gentle Shadow
|
Ashes of the Primordial
|
Ashrennon
|
Ashura Vale
|
Ashura, Heir Of Rebirth
|
Ashura- The Demon Sovereign
|
Asiad the land of lords
|
Asmundre
|
Aspect of the Beast
|
Aspect of the Forsaken
|
Aspect Online
|
Aspects of Heaven and Earth
|
Aspects of Nature
|
Aspiring Demon Lord
|
Assassin Alonne
|
Assassin Gamer [HIATUS]
|
Assassin God
|
Assassin or Princess? Why not both.
|
Assassin Type: The Rifle Girl- Rica Reyes
|
Assassin's Child
|
Assassin's Decree
|
Assassin's fate
|
Assassin's Revival
|
Assassination Highschool
|
Assassination System V.2
|
Assassins and Generals
|
Assassins Who Cleanse Sins Away (Alternative Title: The Sweepers)
|
Assault The World
|
Assimilation
|
Assorted Writings
|
Astin
|
Astlan's Ira
|
Astoerith Online
|
Astora's Paradox
|
Astra Fabulam
|
Astral Arcana: Ethereal
|
Astral Bridge
|
Astral Connections
|
Astral Dungeon
|
Astral Fate Part 1: Starlit Brawler
|
Astral Land
|
Astral Land : The Beginning of Everything
|
Astral Projection
|
Astral Royale Chronicles
|
Astral Son
|
Astral's Oubliette
|
ASTRAL: Awakening of the Saffron Sky-Tamer
|
ASTRAL: Rising
|
Astralfice
|
Astralis Lumen
|
Astrayed Absolution
|
ASTREA - A Game of Different Realities
|
Astro Dog
|
Asunder Online [DROPPED]
|
Asunder Online [Indefinite HIATUS]
|
Asura
|
Asura [Bleach]
|
Asura Ascending
|
Asura Swiftblade
|
Asuras and Dragons **Indefinite Hiatus**
|
Asya
|
Asymmetric Warfare
|
At Death's Door: Legacy
|
At The End of the World
|
At The Fields of Fire and Blood
|
At the Top of the Food-Chain
|
At Wit's End
|
Ataraxia Sanctuary
|
ATCS Ability to Change Size
|
Atemporal Chronicles - Commencement Tale
|
Aterheim
|
Aterheim [DROPPED]
|
Athanatos
|
Athanor
|
Atk 0 Crit All ~My attack stat is negligible, so I can't help but rely on critical hits to succeed!~
|
ATL: Stories from the Retrofuture
|
Atlantean Mage
|
Atlantis
|
Atlas Code
|
Atone Online
|
Atonement
|
Atonement of an Immortal
|
Ator
|
Atreo "The Delusional Demon Prince"
|
Atros Imperium
|
Attached
|
Attack on Titan: Reed Ackerman
|
Attack On Titan: The Peace, I Desire
|
Attuned
|
Audacity Light
|
Audea's Seal
|
Augmented Reality
|
Augmented: Dot Project
|
Augmenting Reality
|
Auntie toasts the VRMMORPG
|
Aurelia Online
|
Aurelion
|
Aurion: The New World
|
Aurora
|
Aurora Eclipse
|
Aurora Scroll
|
Aurora's Sky
|
Ausfagner: The First Exogenous
|
Auspicious Apocalypse
|
Author Rebirth To The Douluo Dalu World
|
Author sent into his own story, now what do I do?
|
Author Vs Protagonist
|
Authority
|
Authority [Dropped]
|
Authority Fought For -- A Simple VRMMO Story
|
Authority: The Prequel
|
Autist Isekai
|
AutoDot
|
Automata Annex
|
Autonomous Machine Arsenal: An Evil Machine's War Record
|
Autumn Grim
|
Autumn to Winter
|
Autumn Winds and Crimson Waters
|
Avalon
|
Avalon'S King
|
Avalon's Shards
|
Avalon: New settlers
|
Avant Garde
|
Avaria: A Pay To Win Adventure
|
Avaritia
|
Avast Online (DROPPED)
|
Avatar of Humanity
|
Avatar of Nature: The Enchantress
|
Avatar: The Legend of Percy
|
Avatar: The Wild Lands (A Medieval 'Avatar: The Last Airbender' Fiction)
|
Avatars
|
Avatars of Myths and Legends
|
Avaunt
|
Ave Akakios
|
Ave Xia Rem Y
|
Avenger
|
Avenger Of Destruction
|
Average Slime
|
Averno
|
Avian | Krieg der Welten (German!!!)
|
Avine: The Journey
|
Avitus Volten's journey through space and time
|
Avoiding the Heroine and Capture Targets!
|
Avonlea
|
Aw Cluck
|
Awaiting Integration (A.I.)
|
Awake
|
Awaken
|
Awaken Online
|
Awaken Online - Conception (A FanFic)
|
Awakened Cheater
|
Awakened in a New World
|
Awakened Warmonger
|
Awakened; Dungeon Tales
|
Awakening
|
Awakening (A Necromancer's Revenge)
|
Awakening (The Necromancer's Legacy)
|
Awakening Chronicles
|
Awakening in Ruins
|
Awakening of a Heart
|
Awakening of a Monster
|
Awakening of an Anomaly
|
Awakening Of Moba Gamer
|
Awakening of the Unknown
|
Awakening the Stars
|
Awe, come on man, really, Again!
|
AWE: Adventures of a Reincarnated Noble Android Girl (Rebooted)
|
AWE: Ballad of 3rd Crown
|
Awful garbage
|
Axe from North
|
Axiom
|
Ayla's Junkyard
|
Aylee
|
Aytelia
|
Azalea
|
Azalon
|
Azarinth Healer
|
Azeal Neralum
|
Azeria: The Era of Black Flowers
|
Azran - Magic King of the Darkness(Finished Volume 1/Dropped Volume 2)
|
Azura of The White
|
Azura the Slayer
|
Azure Lineas: The Blue Line
|
Azure Tale
|
Azure Warrior
|
B
|
B's Grand Adventure
|
B-But I don't WANT to be a protagonist!
|
B.L.A.N.K- The search for the meta
|
B.U.D
|
B1nary Bl00d
|
Babel
|
Babel - The Path To Ascension: Heaven
|
Babel - The Path to Ascension: The Golden Children
|
Baby, I Love You
|
Bacis: The Land of the Gods
|
Back Again
|
Back to Day One (On Hiatus)
|
Back to Pokemon and Earth
|
Backyard Hero
|
Backyard, cute cat eared girl changing her clothes, spirit magic to make breads and saving the world
|
Bacterium
|
Bad ass Bunny - A lack of common sense isekai for no reason.
|
Bad Company
|
Bad Habits {New!}
|
Bad Habits {V2 Out now!}
|
Bad Harem
|
Bad Intentions
|
Bad Light Era
|
Bad Luck
|
Bad Luck World
|
Badass
|
Bag Boy: Adventures in Super Crime.
|
Bakemono: Redemption
|
Baking Bread
|
Balada: When death did not exist, nor yet Eternity Part I
|
Balance
|
Balanced
|
Balancer-Shattered Soul
|
Balancing of the world
|
Ball of Light: Specialization
|
Ballad of Failure
|
Ballad of Mortals
|
Ballad of The Clay Golem
|
Balthazar, a case study
|
Band of Heroes
|
Bandit Host Club
|
Bandit King
|
Bane Blood (On Hiatus)
|
Bane of Ashkarith
|
Banned From Existence
|
Baphomet the Destroyer
|
Barakdor
|
Barbarian Game
|
Barbarians
|
Barbaric beginnings
|
Barbearian
|
Barkept
|
Barrow of the Lost
|
Barter System (or BS like BullSh*it)
|
Base Affection
|
BASE Status: Online
|
BASE Status: Online [An Unlikely Hero's Journey]
|
BASE Status: Update (BASE Status 2)
|
Based on a Life
|
Basically Yaoi, But With Ninjas.
|
Basra
|
Bastard Assassin (18+)
|
Bastard's Crown
|
Bastard's Wrath
|
Bastion Academy Book 1 - Foundations
|
Bastion Academy Series
|
Batman and Spider-man: Year One
|
Baton
|
Battle Academia: Mediocre Martial Artist
|
Battle Avatars
|
Battle City: Rise Of The Blue Spark
|
Battle for the Photon Core [Inter-Universal Protectors: Book 3]
|
Battle is an Art
|
Battle Maiden
|
Battle Maidens
|
Battle Necromancer
|
Battle Necromancer Version 2
|
Battle Necromancer Version 2 - Hiatus
|
Battle of Blackfortress
|
Battle of Lexis
|
Battle of realms
|
Battle Of Supremacy: Heroes and legends
|
Battle Royale across the Universe: The Species Tournament
|
Battle School
|
Battlebond
|
BattleCube
|
BattleField - A Never-Ending Nightmare
|
Battlefield Reload
|
Battlefield Restart
|
Battlefield Restart (Dropped)
|
Battlefield Restart (Edited)
|
Battlefield Restart 2- An Adventure Beyond Greatness!
|
Battlefield Restart 3- An Ascendance Beyond Destiny
|
Battlefield Restart [Reboot]
|
Battlefield Restart- An Identity Beyond Self
|
Battlefield Restart- An Identity Beyond Self (LN)
|
Battlefront
|
Battlegrounds Of Celestial Beings
|
Battlesquire Book I - First Blood
|
Battling for Survival in a New World (On Hiatus)
|
Battling Records of the Chosen One
|
Battling the World
|
Bay City Runaway
|
Bayani
|
Be a man, be a hero
|
Be a Steam Player
|
Be The Icy Beauty: A Xianxia/Cultivation Tale
|
Beach Bum
|
Beacon in the Dark
|
Beanstalk
|
Bear Maid the Princess' Guardian
|
Bearer of the First Flame
|
Bearer of the Red Lotus
|
Bearer of Time: Haze
|
Beast
|
Beast Cultivating System
|
Beast Dao Cultivator
|
Beast fiend
|
Beast Games
|
Beast God
|
Beast Knight
|
Beast mage
|
Beast Master System
|
Beast Mutation
|
Beast of the Mountains
|
Beast of the Night
|
Beast Queen: A LitRPG/GameLit Action/Adventure (book two of Monster Slayer Online).
|
Beast Slayer
|
Beast Tamer
|
Beast Tamer Kayne
|
Beast-Men
|
Beastborne
|
Beastborne (An Isekai LitRPG)
|
Beastkin of GRIM
|
Beastly - Screw being human . . . they suck anyway!
|
BeastMaster Zero By justTYM
|
Beastmastery - A LitRPG Novel
|
Beasts & Bastions
|
Beatrice Santello
|
Beauty of a Chrysalis
|
Became the Strongest Cultivator Just By Existing
|
Because I do not fit well with my life, I am given a restart!
|
Becket The Elf?
|
Become God
|
Become Immortal
|
Become Strong!
|
Becoming
|
Becoming a God
|
Becoming a mesiah
|
Becoming a Vampire in The Space
|
Becoming God
|
Becoming Itachi Uchiha in a Different world!
|
Becoming Legend Companion PokeDex
|
Becoming my rival's love interest!
|
Becoming Renegades in Another World!
|
Becoming the Protagonist of My Own Delusional World!
|
Becoming The Wolfman
|
Bed of Glory "Conqueror of all Worlds"
|
Bedlam - A litRPG Novel
|
Bedrock 岩盤 Ganban
|
BEEADDLEDRUNG — Serial Bogeyman
|
Before a Legend
|
Before Butterfly Effect
|
Before the Day Is Done
|
Before the Fall
|
Before The Hills
|
Before They Came
|
Before They Came (Magical Apocalypse)
|
Before Your Heart Cries
|
Before:After
|
Begin the End
|
Beginners Guide to Dungeoneering
|
Beginners' Guide to Dungeoneering
|
Beginning Of Reality
|
Begsissbbdd
|
Behemoth
|
Behemoth - HIATUS
|
Behemoth hunters
|
Behind Your Smile | 你的笑容
|
Behold the Bacterium
|
Being
|
Being a Bystander is the Best
|
Being A Divine Salamander Is Not So Bad
|
Being A Side Character IS Hard In The Apocalypse
|
Being an adventurer is harder than it looks!
|
Being chased by the heroes because I am a Master Puppeteer.
|
Being Frank
|
Being God is Fun
|
Being Human (Completed)
|
Being in the Grey : Awakening
|
Being the God of Hell is a bother
|
Being the God of Hell is a bother [On temporary hiatus]
|
Being Undead
|
Bellona the Heartless
|
Bellwether
|
Bellwether 1
|
Bellwether 2
|
Beloved Protection from a nine tailed fox
|
Below The Distant Sky
|
Ben the Dungeon
|
Ben's Damn Adventure: The Prince Has No Pants
|
Bend
|
Beneath the Dragoneye Moons
|
Beneath the Iron
|
Benjamin
|
Benjamin's Account of Adventures
|
Benji and The World Spike
|
Berserker- Crank Wars
|
Best Friends Forever?
|
Beta Life, Digital Sorcery Book 1 (A LITRPG Adventure)
|
Beta Test
|
Beta Testing for Implementation of Status and Power
|
Beta World
|
Beta Zero
|
Betrayed by Light
|
Betrayed by Light - Complete Book 1
|
Betrayed in a Blessed World (Web Novel)
|
Betrayer of Humanity
|
Betsu no Sekai de Muteki O Sokushin Suru
|
Better Days
|
Better Than Life
|
Better than one
|
Better To Be Lucky Than Good.
|
Between the planes
|
Between War and Magic
|
Beware Of Chicken
|
Beware of the Synthetic Siblings
|
Beware of Zombies
|
Beyond
|
Beyond Blood and Bone
|
Beyond Blue
|
Beyond Boundless
|
Beyond Death:Monster
|
Beyond Floating
|
Beyond Foundation
|
Beyond Gods
|
Beyond Humanity
|
Beyond Humanity: Lightning Falling and Hook of Rage
|
Beyond life
|
Beyond Limitations
|
Beyond Mortality
|
Beyond The Abyss (Rewrite)
|
Beyond the Balance
|
Beyond the Black Sea
|
Beyond the Bridge
|
Beyond the Dungeon
|
Beyond The Evergreen
|
Beyond The Game
|
Beyond The Game (Abandoned)
|
Beyond The Grey Skies
|
Beyond the Horizon
|
Beyond the Horizon's Eye
|
Beyond the Mists (Shuli Go Vol. 1)
|
Beyond the Ordinance
|
Beyond The Other World
|
Beyond The Primordial Void
|
Beyond The Primordial Void (Dropped)
|
Beyond The Primordials
|
Beyond The Sky
|
Beyond the Star Ways
|
Beyond the Stars
|
Beyond the Veil
|
Beyond The Wall (Complete)
|
Beyond Time and Space
|
Beyond Truth
|
Beyond Worlds
|
Beyond/Odyssey
|
Beyond?
|
BF Training Course
|
Big Damn Heroes
|
Big Leagues
|
Billionaire's Fake Wife
|
Binary Blood
|
Binary of Life and Death
|
Binary Progression
|
Binary Progression: The wild west of MMOs
|
Binary Soul
|
Binded
|
Binded In The Dark
|
Bio Synthesis
|
Biomancer: Songs of Sirens
|
Birds of a Feather
|
Birds of Prey
|
Birth Cult
|
Birth From Darkness
|
Birth of A Death God
|
Birth of a Devil
|
Birth of a God
|
Birth of a Monster
|
Birth of God
|
Birth of Mana
|
Birth of Sin
|
Birth of the Conqueror
|
Birth of the Dragon King
|
Birth of the Dragons
|
Birthday Online
|
Birthright
|
Birthrights
|
Bite
|
Bitten
|
Bitter
|
Bittersouls
|
BKR: Bandit King Reborn
|
Black And White
|
Black Apocalypse
|
Black Beast
|
Black Belly Enchantress
|
Black Blood
|
Black Blood (now on break... it'll be back... Eventually...)
|
Black Book Saga
|
Black Butterfly: The return of the legendary blood slaughters
|
Black Cloak, White Art
|
Black Coin
|
Black Core Summoner
|
Black Death
|
Black Dragon Rising
|
Black Dragons Rain
|
Black Feather
|
Black flame Devil
|
Black God of Lightning.
|
Black Heart
|
Black Heaven Ascension
|
Black Hole Traveler: Beyond Jupiter's Door
|
Black Home
|
Black Ice
|
Black Iron & Cinder
|
Black Kingdom By CallMeDeliverUs
|
Black Knight
|
Black Magic
|
Black Magic Hero
|
Black Meridian
|
Black Mist: Daniek of the Black Blood
|
Black Moon
|
Black Rain
|
Black Rock
|
Black Roses Rewrite - YYH Fanfiction
|
Black Sheep
|
Black Sheep - A Permadeath Book
|
Black Sheep [dropped]
|
Black Sheep's Freedom
|
Black Sky
|
Black Space
|
Black Steel Brandy
|
Black Storm
|
Black Sun
|
Black Sun Rising
|
Black Tears
|
Black Tears (to be revised)
|
Black Tiger God (黑虎神)
|
Black Titan
|
Black Watch Asylum (Hiatus)
|
Black Wind
|
Black Wing
|
Black World
|
BlackCrown
|
Blackened Blossoms
|
Blackfire
|
Blackfire (OELN)
|
Blacklight
|
Blacksmith
|
Blacksmith of the Apocalypse
|
Blackthorne
|
Blackula
|
Blackwood Company (A novel of grimdark sword and sorcery)
|
Blade
|
Blade Judgement
|
Blade of Chaos
|
Blade of Crom
|
Blade of Death
|
Blade of Gaia
|
Blade of shattered reality
|
Blade Origin
|
Blade Quest Vol.1
|
Bladed Advent
|
Blademage Beastmaster
|
Blades and Bonds
|
Blades and Mana
|
Bladevoker's Prerequisites
|
Blake Byron: Paranormal Investigator
|
Blame (Hi-Chan)
|
Blank: a Story of Good Intentions
|
Blanks: Magi Of The Red Desert
|
Blankspace
|
Blarg the Meh Ai
|
Blasphemous Vein
|
Blastocyst
|
Blaze
|
Blaze contractor
|
Blazing Translocation
|
Bleeding Hearts
|
Blend
|
Blenders : tale of the greatest creator
|
Blessed
|
Blessed Time
|
Blessed with a curse (BwC) [Tryout.]
|
Blessing
|
Blight and Bloom
|
Blightbane
|
Blighted
|
BlIghted: A Plague Rat's Tale
|
Blind
|
Blind man's path
|
Blind Punch
|
Blind Spear Goddess
|
Blink
|
Blink, A Dungeon Core Story Unlike Any Other (Because it's terrible beyond belief)
|
Blinker
|
Blockage of Writing
|
Blocked
|
Blood & Carrots
|
Blood & Fire: Insurrection
|
Blood & Paint
|
Blood Amongst the Sand
|
Blood and Bones
|
Blood and Gold
|
Blood and Honor
|
Blood and Honor: Ascension
|
Blood and Honor: Dark Scion
|
Blood and Honor: Deathwalker
|
Blood and Honor: Emperor's Fangs
|
Blood and Honor: Engineer's Aptitude
|
Blood and Honor: Fallout
|
Blood and Honor: Honor among Thieves
|
Blood and Honor: Redemption
|
Blood and Honor: Rise of Atlantis
|
Blood and Iron
|
Blood and Magic
|
Blood and Passion
|
Blood and Sacrifice
|
Blood and Silence
|
Blood and Silver
|
Blood and Soul
|
Blood Born
|
Blood Brothers Rising
|
Blood Calamity
|
Blood Control
|
Blood Creed
|
Blood Cursed: Demon of Time
|
Blood Destiny
|
Blood Drinker
|
Blood Drive
|
Blood Emperor
|
Blood Emperor [Dropped!!]
|
Blood Fractal
|
Blood Imperium
|
Blood in the Wires
|
Blood is dark
|
Blood Knight
|
Blood Mage Bastard (A LitRPG)
|
Blood Merchant Empire
|
Blood Moon Hunters
|
Blood of an Inhuman Hitman
|
Blood of an Inhuman Hitman (Rewrite)
|
Blood of Lilies
|
Blood of the Guardian
|
Blood of the Past
|
Blood of the Serpent
|
Blood Prejudice
|
Blood Princess (completed)
|
Blood Redemption
|
Blood Rejects
|
Blood Rising
|
Blood Rose
|
Blood Sapphire
|
Blood Seekers -- The Monolith
|
Blood Shark
|
Blood Soaked Star
|
Blood system
|
Blood Thick as Steel
|
Blood To-Go
|
Blood Tribute Gacha in Another World
|
Blood Virtuoso
|
Blood Virtuoso: a goblin's story
|
Blood Virtuoso: a monster evolution story
|
Blood Virtuoso: an evolution story
|
Blood World - Sacrifice
|
Blood, Drugs, and a Pinch of Magic
|
Blood-queen Ssyba
|
Blood-Sakura : The Paranormal Residence
|
Bloodborne
|
Bloodgames - A Battle Royale LitRPG
|
Bloodlain
|
Bloodless
|
Bloodline
|
Bloodline plunder
|
Bloodline: World Domination
|
Bloodlines
|
Bloodlust
|
Bloodmoon Destiny
|
Bloodreign
|
Bloodshard
|
Bloodshard: Stolen Magic
|
Bloodshed
|
BloodSmeared
|
Bloodsong
|
Bloody Angel
|
Bloody Conqueror
|
Bloody Dragon
|
Bloody Grass
|
Bloody Hell
|
Bloody Killing Game
|
Bloody little Monster
|
Bloody New World
|
Bloody Specialist
|
Bloody Wave Unlimited
|
Bloody Wonderland
|
Bloom
|
Blooming Thorn in Another World
|
Blud
|
Blue Blood
|
Blue Blood Servant
|
Blue Boundary
|
Blue Core
|
Blue Cruelty
|
Blue Hills
|
Blue Mist
|
Blue Moon Emperor
|
Blue Moon Saga
|
Blue Phoenix
|
Blue Pill
|
Blue Screen Blues
|
Blue Seed
|
Blue Seed - Path of a Mage King
|
Blue Soul
|
Blue Star Cultivator
|
Bluelight Chronicles - Going Solo
|
Blur
|
Blurred Lines and What Crosses Them
|
Blut und Eisen: Blood and Iron
|
Boarding School Blues
|
Bob and Sam up to no Good
|
Bob in the land of the gods
|
Body and Soul
|
Body Molder
|
Body&Shadow
|
Bogatyr
|
Bon Week-end
|
Bonded
|
Bonded Spirits
|
Bonds of a Brother: The Iron Cross
|
Bonds of Gold (HP Fanfiction)
|
Bone and Cartilage
|
Bone Dungeon: Book 1 in the Elemental Dungeon Series
|
Bone Lord
|
Bone...r?
|
Boneca
|
Boneless Beings
|
Bones
|
Bones in the Sun
|
Bonfire of Souls
|
Boogeyman
|
Book 1 of the Falconer series: Hearts of Ice
|
Book 1 of the Immortal Sun Mist Emperor Saga- Novus Magus
|
Book 1 of the Immortal Sun Mist Emperor Series- Novus Magus
|
Book 1 | Hibryds
|
Book 1: A certain magic kingdom
|
Book 1: Demonic Wolfsbane
|
BOOK 1: THE CURSE OF ASMODEUS -- (a Perth's Accidental Superheroes series)
|
Book 1: There is No God
|
BOOK 2: THE WRATH OF ASMODEUS -- [a Perth's Accidental Superheroes series]
|
BOOK 3: THE REVENGE OF ASMODEUS -- [a Perth's Accidental Superheroes series]
|
Book 4: Escape From Planet Of Asmodeus [ A Perth'S Accidental Superheroes Series ]
|
Book 4: The Brothers Dyne
|
BOOK 5: THE RETURN OF ASMODEUS -- (a Perth's Accidental Superheroes series)
|
Book Of Chaos
|
Book of Creations
|
Book of EscaLod
|
Book of Fates: The Forgotten Shores of Ferax
|
Book of Heroes - Rise of the Shadow Walker
|
Book of Kindness
|
Book of Liz
|
Book of Monsters
|
Book of Mortus
|
Book of Reality
|
Book of Sand
|
Book Of Soul
|
Book one: Change
|
Book One: Queen of The Forest
|
Book Worm
|
Booked
|
Bookkeeper
|
Bookworld Online: Marsh Man
|
Bookworld Online: The Rogue Necromancer
|
Bookwyrm
|
Boop!
|
Borderlines
|
Bored Evil
|
Bored Gamer in Other Worlds
|
Bored Hero
|
Boredom Made Me Do It.
|
Born a Demi-God (Hiatus)
|
Born a male xenomorph
|
Born among the Stars
|
Born as Slime In New World
|
Born From Evil
|
Born in Abyss: Dark Devil
|
Born in Abyss: The Dark Devil
|
Born In One (one piece fanfiction)
|
Born of Dusk
|
Born of Hate: Spawn of Hatred
|
Born to Heal, Grown to Steal
|
Born under the moon
|
Born with a Dragon Tattoo(Dropped)
|
Borne of Caution
|
Borneo
|
Borrowed Time
|
Borrowing Divinity
|
Boruto:narutos next generations: the saga of daemon
|
Boss
|
Bottled up wishes
|
Bottom Rung (Dungeon Runner, book 1)
|
Bottomless earth
|
Bound
|
Bound by Blood
|
Bound by Duty
|
Bound by Fate
|
Bound by life and death
|
Bound by Moonlight
|
Bound in the Dark
|
Boundless (Completed)
|
Bounty Cats
|
Bow of the North
|
Brain Cultivators
|
Brainiac Dungeon
|
Branch Adventurers Guild
|
Branch Adventurers Guild [Dropped]
|
Brand New Night
|
Brand New World
|
Brand of the Dragon
|
Branded
|
Brave Realm Odyssey - Adventurer Resolution
|
Brave Soul
|
Brave World Online
|
Bravest Soul
|
Breach World Championship 2081
|
Breaching Reality
|
BreakDown
|
Breaker of Chains
|
Breaking Chains
|
Breaking Horizons: Book 1: Snared Origins
|
Breaking Limits: A DBZ Fan-fic
|
Breaking Point
|
Breaking Syd
|
Breaking the constellations
|
Breaking the Mold
|
Breaking up, No Joke
|
Breakout: The Evolution of a High School Nerd
|
Breakout: What Did I Get Myself Into?
|
Breakout: What Did I Get Myself Into? (Original English Light Novel)
|
Breakthrough
|
Breathe in the Embers
|
Breathing Hurts: Short Stories
|
Bred to Die: Confessions of a Vat Grown Troll
|
Brewer King
|
Brian Saves the World, Maybe
|
Brian the Drow: A LitRPG Adventure
|
Brian'S Note Book
|
Briars and Thorns
|
Bricks of The Temple
|
Bride of Prince
|
Bride of the Dark Lord
|
Bridge of Storms
|
Bridging The Gap; The Final Records In Unova: An Autobiography
|
Bright "yuri"
|
Bright Battle Story: Tactics Heart
|
Bright Decay
|
Bright Feather
|
Bright Night Online
|
Brightest Doom
|
Brightstar: The Rising Superhero
|
Brimstone
|
Brimstone Fantasy
|
Bring me back to change that life!
|
Bringing Anime Skills to Another World Using Imagination
|
Bringing Chaos to the Immortal World with God's Powers
|
Brink
|
Briox the Magus
|
Broadway Blue
|
Broderick's Home for Curious Kids
|
Broken
|
Broken Angel
|
Broken Chains
|
Broken chains of mortality
|
Broken Cheat
|
Broken Is Beautiful
|
Broken Kaleidoscopes
|
Broken Lance
|
Broken Pieces
|
Broken Reality
|
Broken Realms: Battle of the Gods
|
Broken Shards
|
Broken Skulls, a Skeleton's Tale
|
Broken Sky and Shattered Earth: Apocalypse Convergence
|
Broken Soul (MoTheGreatOne)
|
Broken System
|
Broly In Naruto
|
Broly In Naruto (COMPLETED)
|
Bronze Mirror
|
Bronze Wings: A Steampunk Pirate Harem Adventure
|
Brotherhood of Assassins
|
Brothers in Arms
|
Brought my Shotgun to the Seven Seas
|
Brujas de la Noche
|
Brutality
|
Bruxas da Noite
|
Bubbles Goes Wild
|
Bubin
|
Buddy System
|
Buffy's New World Order
|
Bug (title pending)
|
Bug in This Game
|
Bugs
|
Build-A-Harem (ongoing)
|
Builder of Power
|
Building a nation and make its citizen happy
|
Building A village in Naruto Universe
|
Building Home
|
Building Home Book 2 - Rescue
|
Building my faction in another world
|
Building the Star Forge Empire
|
Bullet Blonde
|
Bullet In Spell Land
|
Bullets & Spells
|
Bumi
|
Bunkercore
|
Bunnymancer
|
BurgerPunk: Pizza Time
|
Buried with Secrets
|
Burn Artist
|
Burn in fel fire
|
Burned Phoenix Rises
|
Burning Heavens
|
Burning Soul
|
Burning Stars, Falling Skies
|
Burning Winter
|
Burra: Short Stories In the Shaper Universe
|
Business Manager in a Barn
|
But I never wanted to be involved
|
But, Have You Read This Yet?
|
Butterfly Weed
|
Butterfly's Dream
|
By Any Magical Means Necessary
|
By The Sword
|
By Word and Deed
|
Byōki no hitobito wa betsu no sekai ni tsurete ko raremashita.
|
C l a i r e
|
C.O.L.A. Beration
|
Cadorna Keep
|
Caesar Augustino [Infinite Dendrogram Fanfic]
|
Caesar Augustino [Original Character-centric Infinite Dendrogram Fanfic]
|
Caged Demons: Entrapment
|
Caged. Unleashed. Extinct.
|
Cain's Daughter: Baptism of Fire
|
Calamity
|
Calamity Blade
|
Calamity Lord Academy: What is a Human Doing Here?!
|
Calamity Mandate
|
Calamity Messenger
|
Calamity Star
|
Calandoris
|
Calavera
|
Calforn Chronicles (Original)
|
Caligo Tenebris
|
Calixon - Machiavellian/Satirical Romance
|
Call it a Mission
|
Call Me Emperor
|
Call of Carrethen
|
Call of Tardigrade
|
Call The Manager
|
Calla
|
Called Upon
|
Calm Calamity
|
Cambion
|
Camelot Defiant
|
Camelot Dungeon
|
Camelot Overthrown
|
Camelot Resurgent
|
Camiare: An Isekai
|
Can a holy hero be born from such a person?
|
Can a Lich Cry
|
Can I Borrow @You?
|
Can i please get a female demon lord on the 10th world(Hiatus)
|
Can I really create a VR game?
|
Can I really keep my Goddess Wife to myself and away from all the Crazy OP MCs?
|
Can somebody save me? Really? No one?
|
Can you Hear the Stars Calling?
|
Can you please stop killing me? a lit RPG adventure
|
Can't a Girl be a Fearsome Demon Lord?
|
Can't Cure Deceit
|
Canaan: My World To Live
|
Canary
|
Candor: The Forgotten House
|
Candor: The Lost House
|
Caninstinct
|
Caninstinct (Hiatus until January 2021)
|
Cannibal Cheerleader
|
Cannibal Dungeon
|
Cannon Fodder
|
Cannon Fodder - A LitRPG Story
|
Cantaga Station
|
Canticle: Code Caligula
|
Cantina KnowWhere
|
Cantrip - A Wizard's Tale
|
Capo: Rise of a Gang Lord
|
Captive God
|
Captive Hero
|
Carabell's Lowlife
|
Card Game
|
Card Hero 2020
|
Card Master System
|
Cards of the Lake
|
Cards of the Royal Guard
|
Carefree Cultivation
|
Careless Wish
|
Cariosus
|
Carl@Fire
|
Carn Online: Second Chances
|
Carnage
|
Carnivores: Aurora
|
Carrion
|
Carrion Crow
|
Cartilage Of Life
|
Cartoon Vs Rpg World[Working Title]
|
Carus
|
Carus - Libertas
|
Carving a Path
|
Casa do Diaño: The Fool
|
Case Notes: L0St
|
Casimir the Savior
|
Cassandra
|
Cassidia
|
Cassidia Book Two: The Royal Guard
|
Cassidy's Change
|
Cast
|
Cast 2
|
Cast In Steel - Transferance
|
Cast Out
|
Cast Under Ellitis
|
Castaway of Aturge
|
Casted Away {will probably change the title}
|
Castle Kingside
|
Castlebound
|
Casus Belli
|
Cat Girl Was Not My First Choice
|
Cat Who Walks Thru the Wall
|
Cata Maestra
|
Cataclysm
|
Catalyst
|
Catalyst: The Trading Card Game
|
CATastrophe
|
Catastrophe Teacher
|
Catastrophic world
|
Catch All The Girlfriends!
|
Catch Me If You Can (a PicYourStory entry)
|
Catch the Wind
|
Catgirl in the Pantry
|
Catgirl in the Pantry: Sample Chapters and Bonus Content
|
Catgirls of GRIM
|
Catmaster Online: A LitRPG Series
|
Causality Hopscotch
|
Cautious Of The Intruder
|
Cave Crawl
|
Cave of the Fallen
|
Caves of B´lo
|
Caveship
|
Cayleth
|
Cecil Bee's Flash Fiction
|
Cedric Dustbrook and the Woebegone's Revenge
|
Celeste Academy
|
Celestial Beings
|
Celestial Beings: Evolution
|
Celestial Black Star
|
Celestial Chance
|
Celestial Child
|
Celestial Forge
|
Celestial Fox
|
Celestial Games
|
Celestial Games (Book 1) Original
|
Celestial Magus
|
Celestial of the Void
|
Celestial Realms
|
Celestial Reaper
|
Celestial Spark
|
Celestial Trinity
|
Celestial Void
|
Celestine
|
Cennet's Cyborg
|
Center Stage: Deception
|
Centifire: Deciphering Magic
|
Centipede
|
Centipede: A LitRPG
|
Central Intelligence Ashitra (Isekai)
|
CEO Cinderella - A modern humorous retelling
|
CerberuS Awakening
|
Cerberus Wakes
|
Ceron Devourer Of Souls: Book One
|
Ceusawah
|
Chain Chronicles of Glory Zero Day
|
Chain Warden
|
Chain Worlds: In the Name of the Allfather
|
Chain Worlds: Rise of Three
|
Chain Worlds: The Third Fleet (Completed)
|
Chained
|
Chained Thorn
|
Chains
|
Chains of Blood
|
Chains of Dominion
|
Chains of life
|
Chains of logic
|
Chains of Servitude
|
Chains Saga -
|
Challenge: Get Atsuko a Great Life!
|
Challenged Dungeon and the Arrival of Mana
|
Challenger of God's Land
|
Challenging Destiny
|
Chameleon: My True Face
|
Champion is Playing
|
Champion of Chaos
|
Champion of Death
|
Champion Of Goddess Of Light
|
Champion of the Smith
|
Champion's Path
|
Champions
|
Champions and Hunters: Two Worlds Collide
|
Champions of the Boundary
|
Chamrosh
|
Chance for Change
|
Chance Ignition to Crimson Volition (Six Chances)
|
Chance Meetings
|
Chance to a Fantasical World
|
Chandelier
|
Change Is Inevitable
|
Change My Heart, Change My World, Change Me
|
Change My Mind (Updates Fridays)
|
Change The World
|
Change's
|
Change: New World
|
Changed Soul
|
Changement : Version Face [French]
|
Changement : Version Pile [French]
|
Changes
|
Changing Fate
|
Changing Monster
|
Changing Oneself
|
Changing the course of life
|
Changing World
|
Chao Mundi
|
Chaos
|
Chaos (old)
|
Chaos Begets Chaos [Lessons Learned the Hard Way book 1]
|
Chaos Cannot Be Controlled [Lessons Learned the Hard Way book 1]
|
Chaos Children: Devourer
|
Chaos Cloud
|
Chaos Destiny
|
Chaos Dragon
|
Chaos Fiend in the Naruto World
|
Chaos Fountain | A Chronicles of Ascension Novel
|
Chaos Godking (Old)
|
Chaos Godking (ReWrite)
|
Chaos Of The New Era
|
CHAOS ONLINE : Paradise of Criminals
|
Chaos Rising
|
Chaos Sequence
|
Chaos Theory
|
Chaos Traveler
|
Chaos Traveller
|
Chaos Wave
|
Chaos World
|
Chaos World Chronicles : Dissolution of Cascany
|
Chaos Zone online(CZO)
|
Chaos: Balance within
|
CHAOS: The Youth and The World of Wonders.
|
Chaotic Anomaly
|
Chaotic Awakening
|
Chaotic Berserker
|
Chaotic corner
|
Chaotic Duality
|
Chaotic Emperor
|
Chaotic Shadows (Temporary Name)
|
Chaotic Souls (Dropped...)
|
Chaotic Symphony
|
Chaotic|Nonsense
|
Chapter and Verse
|
Chapters of Pain [Anthology]
|
Character Overload
|
Character Wonders
|
Charlie Foxtrot Zero
|
Charlie Foxtrot Zero: Existance Saga Book 1
|
Charlotte Powers: Diary of a Would-Be Superhero
|
Charon's Touch
|
Charred The Final Hope
|
Chase the Thrill
|
Chase Your Dreams
|
Chasing Experience
|
Chasing Freedom
|
Chasing Legacy
|
Chasing Paradise
|
Cheat Hero
|
Cheater God
|
Cheaters Always Win
|
Cheaters Always Win (REVAMPED)
|
Cheating Monster
|
Cheating Side Kick
|
Cheeky little buggers.
|
Cheese Dungeon
|
Cherry Outrage
|
Cheshan
|
Chessboard War (The God's Game Book One)
|
Chessboard War: The God's Game Book One[First Draft]
|
Chevalier of the End
|
Chidetan Odyssey
|
Child God
|
Child of Bone and Darkness
|
Child of Fate
|
Child of God's Fantasy
|
Child of God's Fantasy (HITAUS UNTIL FURTHER NOTICE)
|
Child of Mystery
|
Child of Night
|
Child of Nightmares
|
Child of Terra
|
Child Of The Moon
|
Child of White
|
Children of Day Zero
|
Children of Diaspora : Seeking Shelter
|
Children of Kathaldi
|
Children of Nemeah
|
Children of Ohst
|
Children of Sol
|
Children of the Galaxy
|
Children of the Halo
|
Children of the Lodestar
|
Children of the Plague
|
Children of the Sands
|
Children of the Singularity (S4)
|
Children of the Skies
|
Children of The Sky: Heartcore
|
Children of the Sun (Ancient
|
Chilledren
|
Chillin' in a dungeon
|
Chimera
|
Chimera Commander
|
Chimera Dire
|
Chimera King: The Rebels of Last World
|
Chimera of Reality - Living in a Virtual Mirage - Season One
|
Chimera of Reality - Season One - Living in a Virtual Mirage
|
Chimera, The Unwilling Familiar
|
Chivalrous Thief
|
Chocolate Obsessed Genius Mage
|
Choice of Fate: Online
|
Choice of the Last
|
Choices
|
Choose Your Class
|
Choosing Magic
|
Chopin's Penny :: (The Reincarnated Diaries of 'The Ant and Grasshopper' through a Classic Composer and a Lazy Witch)
|
Chopin's Penny :: (The Reincarnated Diaries of A Classical Composer and a Freeloading Lazy Witch)
|
Chora (The Crystal Saga series book 1)
|
Chosen
|
Chosen - A CYOARPG
|
Chosen Chaos
|
Chosen Fate (Reincarnation Giver)
|
Chosen of Death
|
Chosen of the Mirth
|
Chosen of the Veiled God: Death March
|
Chosen Shackles
|
Chosen Sun
|
Chromatic Caverns
|
Chromium
|
Chronicle of the Fated General
|
Chronicler's Tale
|
Chronicles of a dark lord
|
Chronicles of a Dungeon Core
|
Chronicles of a Dungeon Core (Side Stories)
|
CHRONICLES of a PC Gamer Stuck Inside an RPG (Book Two: Successor)
|
CHRONICLES of a PC Gamer Stuck Inside an RPG Book One: Duelist
|
Chronicles of a Wing Commander
|
Chronicles of Alex Chase
|
Chronicles of Ard : The Silver Demi-Dragon
|
Chronicles of Arrath
|
Chronicles of Athionia
|
Chronicles of Creation - Tale of the Elder Witch
|
Chronicles of Elulra
|
Chronicles of Firs
|
Chronicles of Genticus: Invasion of the North
|
Chronicles of Grand Deus
|
Chronicles of Gray
|
Chronicles of Heroes: The White-Fire Covenant
|
Chronicles of Hui Yuan
|
Chronicles of Ionathan Spellweaver
|
Chronicles of Ionathan Spellweaver [pending rewrite]
|
Chronicles of Isla - Rise of Ryuk
|
Chronicles of krendreon
|
Chronicles of Leofric [Dropped]
|
Chronicles of Magnus
|
Chronicles of Mana
|
Chronicles of Marda
|
Chronicles of My New Life as a World Owning God
|
Chronicles of Phartassia: My Teacher, Fox
|
Chronicles of Soma: Rise of a King
|
Chronicles of Sora: All over again
|
Chronicles of Sora: Ruler of Rules
|
Chronicles of The A.I
|
Chronicles of the apocalypse
|
Chronicles of the Blade By GnomeBob
|
Chronicles of The Dragon Empire: Rise of the Dragon King (Rewritten)
|
Chronicles of the End
|
Chronicles of the Exalted Sun Child
|
Chronicles of the Last Hermit
|
Chronicles of the last Leïn
|
Chronicles of The Magical Sword Sovereign
|
Chronicles of the Paranormal
|
Chronicles of the Radiant God
|
Chronicles of The Random , Unfinished Stuff I Wrote.
|
Chronicles of The Shell Mage
|
Chronicles of the Shura Clan
|
Chronicles of the Sovereign Otherworlder
|
Chronicles of the Spider
|
Chronicles of the StarFighters
|
Chronicles Of The Storylord: 12th Chronicle - Origin
|
Chronicles of the Survivor
|
Chronicles of the Sword Dragon
|
Chronicles of the Tiger Immortal
|
Chronicles of the Titanomachy
|
Chronicles Of The Voidbearer
|
Chronicles of the Wanderer, Siúlóir
|
Chronicles of the Weakest Wind Mage
|
Chronicles of Thyderalis - A Hero Returns
|
Chronicles of Trial and Error
|
Chronicles of Trial and Error (re-write)
|
Chronicles of Two Worlds
|
Chronicles of Xod
|
Chronicles of Xod (returning from hiatus)
|
Chronicles of Zach
|
Chronicles Of Zaria - Book 1: Dawn Of Akaal
|
Chrono Born
|
Chronokinesis
|
Chronos Ascending
|
Chrysalis
|
Chrysanthemum
|
Chuunibyou in Cultivation World
|
Ciarra the Cold
|
Cielo Pantasia
|
Cinap: Academy
|
Cinder Roots - A Treant's Tale
|
Cinder Souls II
|
Cinderella's Spaceship
|
Cinnamon Bun
|
Cionis Key
|
Cipher's Quest
|
Ciphered Realm (A LitRPG Adventure)
|
Ciphered Realm: A LitRPG Adventure
|
Circle of Shards
|
Circle Star Isekai. A New Beginning.
|
Circle System
|
Circumstance
|
Circumventing Fate
|
Citadel World: The URANUS code
|
Citizen Rat and Other Stories
|
City dungeon
|
City Dungeon Abyss
|
City Management
|
City of Champions Online
|
City of Devils
|
City of Ohst
|
City Of The Banished
|
City Of The Dead
|
City of Vengeance
|
City States (Working title)
|
Civilization: Rise of Empires
|
Clademundi: A Post-Apocalyptic DMMORPG
|
Claimed
|
Claimed by the Gods
|
Clan of Exiles
|
Clan of The Alchemist
|
Claret
|
Clash of Gods
|
Clashing Worlds
|
Class Crystal Battles
|
Class Evolution
|
Class Neutral: Stranger is Coming
|
Class Z Calamity
|
Class-A Threat (Disgardium, Book 1) by Dan Sugralinov
|
Class-Z Calamity
|
Class: God-slayer
|
Class: Master of Time
|
Class: Space Marine
|
Classless
|
Classmancers - A MOBA Esport Story
|
Classroom of Doom
|
Clavomancy
|
Clay the Golem
|
Clean Goblin
|
Clean Slate
|
Cleaning Up The Future
|
Cleaning Up Your Mess
|
Clear
|
Clear Binding
|
Clear River Flowing Silently
|
Cleric or Necromancy?
|
Clerical Error: A Challenge of Vircon Adventure
|
Cliche Necromancer Story
|
Cliche?
|
Cliché cliché the classic cancer cliché
|
Cliché Fantasy I
|
Climber: Towers of the guardians
|
Climbing out of the Ruin
|
Clock Link: A Story of Magic and Murder
|
Clockwork
|
Clockwork Memoria
|
Clockwork powers? Sure! Wait, why am i on a fantasy world?
|
Close Your Eyes
|
Closed Beta [A Star Nova Prequel]
|
Cloud 9 Rebirth: Adventure In New Dwarden (Working Title)
|
Cloud Academy Aerendel
|
Cloud Dungeon
|
Cloud Rider
|
Cloud Shrouding the Sky
|
Cloudlark
|
Clouds of Fauna
|
Clover: A Seeker's Story
|
Clue
|
Co:ExisT (The Calm Before the storm)
|
Coalesce
|
Coalescence of Two Lifetimes
|
Coco-chan: The cat that wants to conquer the universe
|
Coda's adventure
|
Code Antony
|
Code Death[Dropped]
|
Code Jumper - A GameLit Novel
|
Code name [Blood Cry]
|
Code Name: Genesis
|
Code Red
|
Code: Ragnarok
|
Codename Deathwish
|
Codename Prometheus
|
Codename: Eldritch - Screw Sanity . . . I've lost it anyway.
|
Codename: Freedom - When VR Gaming Hurts
|
Codename: Raven
|
Codename: Reaper
|
Codex
|
Codex Haereticorum
|
Codex of creatures: Salvation
|
Codex of Shadows
|
Codger
|
Coeus?
|
Coffee & Slime
|
Cogseer
|
Coiling Dragon: Untold Stories
|
Coin
|
Cold
|
Cold Expanse
|
Cold Havoc: Carl, the Destroyer
|
Cold Heart
|
Cold Reign
|
Cold Space, a LITRPG space story.
|
Cold Steel Dig
|
Cold Sword Mistress
|
Collapse Point Harmony
|
Collateral
|
Collection of Gender Swapping Shorts
|
Collection of ideas
|
Collection of Short Horror Stories
|
Collection of Short Stories
|
Collection of Things [very bad, don't read]
|
Collector's Guild
|
College Diaries
|
College Student To Chosen Hero
|
Collision of Myths
|
Colonize
|
Colopra Online: The Artificer
|
Colorful World
|
Colors
|
Colosseum 72
|
Colosseum of Indossus
|
Colossus of Catastrophe
|
Colossus' Dream
|
Colossus' Legacy
|
Coma (LitRPG Story)
|
Combat Archaeologist: Rowan
|
Combat Origin: A Dystopia Gamelit Adventure
|
Come And See
|
Come Sevenfall
|
Come to Management
|
Come to the Tree
|
Coming Back Home
|
Coming Down
|
Command Line: Failure
|
Commander Daggen
|
Commoner Online
|
Companion Farmer
|
Company of Heroes: Power Fantasy
|
Competitive Edge: The Rebirth of an Idiot
|
Compilation of short stories
|
Complaints: Working At A Store That Sells Gender-Swapping Products
|
Completely Lost (Dropped)
|
Completing the List
|
Compline
|
Composer
|
Conba Shiroppu
|
Concept of the Novel
|
Concept Slayers
|
Conception
|
Conclave of Tyrants
|
Concordant Fall
|
Concrete Chaos
|
Condition Evolution
|
Confessions of a 22 year old Introvert
|
Confessions of a Teenage Celebrity
|
Confessions of the Magpie Wizard
|
Conflagration - A Fantasy Haven Series part 1
|
Conflicted Feelings
|
Conflicts of Eriador stories
|
Confluence
|
Congratulation, You got the Job!
|
Congratulations, You're Dead!
|
Conjured Villain
|
Conquer
|
Conquer Everything
|
Conquer the World
|
Conquer Your Own Fate
|
Conquering The Heaven
|
Conquering the World as a Goddess
|
Conqueror
|
Conqueror Online: Soul Summoner
|
Conquerors
|
Conquerors (Dropped)
|
Conquest Apocalypse
|
Conquest of Arcadia
|
Conquest of the Evolutionizing Extraterrestrial Being
|
Conquest: A LitRPG Story
|
CONQUEST: The Dungeon Core Gambit Book One (SAMPLE)
|
Conscientia
|
Conscious, Conscientious
|
Consciousness Error
|
Conscripted
|
Consignor
|
CONSOLE ~Another World Transfer Chronicle Starting From the Conversation with God~
|
Consor
|
Consort
|
Conspiracyland
|
Constantine
|
Constellations
|
Construct Your Fate
|
Consume
|
Consume: The Scourge Wars Book 4
|
Consuming Earths, Devouring Skies
|
Contact - Humanity Screams Book 0
|
Contact First
|
Containment Pacific
|
Contender
|
Continental Chaos
|
Continue Online - Sample
|
Continuum
|
Contract from the Abyss
|
Contract Summoner
|
Contract: Restart
|
Contract; A Bless with a Curse
|
Contractbound
|
Contractor of Flames
|
Contradiction
|
Control + Alt + Sadit
|
Control the Universe
|
Controllers
|
Convergence Cycle Book One: Ranger of the North
|
Convergence of Fates
|
Convergence of Night
|
Convergence Series
|
Cooking with Oinos
|
Cool Heads, Hot Hearts
|
Copper Claws
|
Copperscale
|
Copy, Paste: The Misadventures of Milo Two
|
Copyright [HIATUS]
|
Cor Navim
|
Corbeau
|
Core
|
Core .001
|
Core and Guide
|
Core Chronicles
|
Core Evolution
|
Core of Metal, Heart of Blight
|
Core Wars
|
Core Worlds
|
CORE: The Volcanic Dungeon
|
Cores
|
Corinth
|
Corner West and Lenchen
|
Corners of my soul
|
Cornucopia of Hope
|
Coronation Day
|
Corpse
|
Correcting My Martial Path
|
Corridor of Fire
|
Corrosion
|
Corrupted
|
Corrupted Guardian
|
Corrupted soul
|
Corrupter of Worlds
|
Corruption
|
Corruption of the Aether
|
Corruption of the Demon Lord
|
Coruscant Ela
|
Cosmic Creator
|
Cosmic Plague
|
Cosmic Progenitor
|
Cosmos
|
Cosmos Traveller
|
Cosmos-Slaying Calamity Blade
|
Counter Magic
|
Counterattack: Reborn into Warmth
|
Counterpart
|
Counterwizard
|
Countless Dreams
|
Countless Minds
|
Coupe - The Art of Rebellion
|
Couple That Can't Touch
|
Couplet
|
Covenant Sinners: The Origin of a Demon Queen
|
Cowboy, Reborn.
|
Cowboys and Wizards
|
Crack in the Vault of Heaven
|
Cracked Coffins {Book One}
|
Cradle
|
Craft Codex
|
Craft Codex: Leveless Adventure in an Altered World
|
Craft Codex: Leveless Adventurer in an Altered World
|
Craft Codex: Part-time Adventurer in an Altered World
|
Craft Spirits
|
Crafter's Passion (AKA Gleaners' Guild)
|
Craftsman
|
Craftsman of Blood: Demonic Beginnings
|
Craftsman System In My Hero Academia
|
Craftsman System In My Hero Academia (COMPLETED!)
|
Crafty devil
|
Crain Chronicle
|
Crash Alive
|
Crashed Into Fantasy
|
Crashlanded on an Unforgiving Hellscape
|
Craven: Reincarnated Mercenary[First Draft]
|
Craving for Potions (RAGEQUIT)
|
Crazy Blacksmith
|
Crazy Diamonds
|
Creases and Folds by Origami
|
Creating A Continent of Magic
|
Creating a world [Russian]
|
Creating a World RPG
|
Creation - The Path of a God
|
Creation Online: Origins
|
Creation system
|
Creative Dumpster Fire
|
Creative thinking is everything I have
|
Creative Writing Prompts Writing Practice
|
Creativity Can Fix Things
|
Creator
|
Creator Advance
|
Creator Goddess Lisa Strife - Book 00: Welcome to Your New Normal
|
Creator of Worlds
|
Creed
|
Creep
|
Crest Fallen
|
Crestruction
|
Crew of the Helianthus
|
Cries from the Dust (Working title)
|
Criminal Lord
|
Crimson
|
Crimson Cross: The Proving Grounds
|
Crimson Crow: Thief of Fortune
|
Crimson Crown
|
Crimson eyes in a world of cultivation.
|
Crimson Gloom
|
Crimson Ice
|
Crimson Love(BL)
|
Crimson Marble
|
Crimson Moon
|
Crimson Night Sect Young Ancestor
|
Crimson Pervert
|
Crimson Qi
|
Crimson Sky
|
Crimson Snow
|
Crimson Violet
|
Crimson: Life in the Virtual World
|
Crisis
|
Crisis of Civilisation
|
Crisis Zero
|
Critical Hero
|
Critical Hero Arc 1: The Union of Two Cursed Swords
|
Critically Impaired
|
Crocodile Reincarnation Story
|
Croenas story of creation
|
Cross Gun
|
Cross Roads: God's Reminder (Book Two)
|
Cross world crisis
|
Crossing Over: Chronicles of DxD
|
Crossing Paths with a Snake
|
Crossing The Divide
|
Crossliner's coup d'etat
|
Crossroad Paradise
|
Crossroads
|
Crossroads - Tournament of All
|
Crow
|
Crowfeathers
|
Crowfeathers Part I: An Ill Wind Over the Capital
|
Crown of Darkness
|
Crown of Despair
|
Crown of Heroes
|
Crown of the martyr and martyr of the Crown.
|
Crown of Thorns
|
Crownless: Veni Vidi Vici.
|
Crows Feast
|
Crucible - A Lost Dungeons Tale
|
Crucible of Worlds
|
Crucis
|
Cruel Affinity
|
Cruel reality
|
Crushed and Cursed
|
Crushing Hearts
|
Cry little demon
|
Cry of the Mer
|
Cry of the Mer Extras
|
Cryptic Asunder
|
Cryptic Asunder (Book one)
|
Crysolis
|
Crystal Core
|
Crystal Creature
|
Crystal Down
|
Crystal Evolution! The Tales of a Ruler Crystal!
|
Crystal Guardian
|
Crystal Heart
|
Crystal High
|
Crystal Magic
|
Crystal Shards Online - A LitRPG Series
|
Crystal Skies
|
Crystal Trouble.
|
Crystillya: Two Worlds
|
Cuddle & Monster
|
Cultivating Civilization
|
Cultivating Dungeon
|
Cultivating Earth
|
Cultivating Earth [Hiatus]
|
Cultivating Elf
|
Cultivating Godslayer: Another GameLit Harem Novel About a Cultivator Who Reincarnates in a World of Magic
|
Cultivating Magical Kingdoms ?✨?
|
Cultivating Monster
|
Cultivating Queen of the 13th Realm (slow releases due to me being lazy)
|
Cultivating Slime
|
Cultivating the Cosmos
|
Cultivating the Universe (Temporary Hiatus [Until June])
|
Cultivating with Anime System
|
Cultivation Anomaly
|
Cultivation Anomaly Type 1B
|
Cultivation Anomaly Type 7A Variation 3Z
|
Cultivation Apocalypse
|
Cultivation Apocalypse [Rewritten Version]
|
Cultivation at home!? ( CAH!? )
|
Cultivation at Home!?00
|
Cultivation Bug Fuyo
|
Cultivation Can Wait; Anime Is My Fate!
|
Cultivation Is Now A Reality
|
Cultivation of a Phoenix
|
Cultivation Online
|
Cultivation Path of the Black Dragon
|
Cultivation Path of the Black Dragon [No Longer Being Written]
|
Cultivation Queen
|
Cultivation Sect in Great Age of Piracy
|
Cultivation System
|
Cultivation Systems
|
Cultivation with a status screen
|
Cultivator in a Magic World
|
Cultivator in Narutoverse
|
Cultivator In The Magus World
|
Cultivator's Fantasy
|
Cultivators are extinct!
|
Cultivators: Journeys (Hiatus)
|
Curiosity Didn't Killed the Dungeon
|
Curiosity killed the cat
|
Curiosity Killed The Imp
|
Curo [Hiatus]
|
Currently Being Edited Into Actual English
|
Curse Eater
|
Curse from God, Live a Thousand Lives: Second Life
|
Curse Gunner
|
Curse of Change (Hiatus)
|
Curse of Clwyd
|
Curse of Hades in Another World
|
Curse of The Dark Side
|
Curse of the Drakku: Origins
|
Curse of the Forsaken
|
Curse of the Kat
|
Curse of the Kat (Dropped)
|
Curse of the Reaper
|
Curse's Curse (On-Hold)
|
Curse: Birth of The Cursed Magician
|
Cursed Alter (First Draft)
|
Cursed Anti-Hero Against the Gods
|
Cursed Armor Reincarnation
|
Cursed Blood
|
Cursed by a goddess...
|
Cursed child
|
Cursed Child of the Eternal Realm
|
Cursed Children
|
Cursed Era
|
Cursed Heroine
|
Cursed Reincarnation
|
Cursed With Ice
|
Cursed World (LitRPG Fantasy Adventure)
|
Curses, magic, and curiosities.
|
Curves of the Game
|
Custom Class
|
Cute Psychic
|
Cutest in the Omniverse
|
Cutthroat
|
Cy
|
Cyber Clash Online - Synchronization
|
Cyber Samurai - A Cyberpunk LitRPG
|
Cyber V - RoyalRoad Edition
|
Cyber World Alpha
|
Cybercity
|
Cyberhawk
|
Cybernetic Array God
|
Cybernetic Dragon
|
Cybernetic Monster Lord
|
Cyberworld
|
Cyberworld ALICE: Terror Rising
|
Cycle of Ruin - Landing: A LitRPG Series
|
Cycle of the Tides
|
Cycles of Power
|
Cymurai
|
CYOA -- Pandora's Gacha World
|
Cyrus: Return of The Persian Monarch!
|
Czar Of Combat: Kings
|
CZEPTA // Light from Darkness
|
CZEPTA // Light from Darkness - An Esoteric Cultivation Adventure
|
D&D Adventure Story : Hoard of the Dragon Queen
|
D+E - Vertigo's Scent
|
D-Days
|
D-INJECT Second Birthday
|
D-Tripper
|
D.W
|
Daddy Dearest
|
Daedalus
|
Daemon Born
|
Daemon Dungeon Core
|
Daemon: A tale of darkness
|
Daemonia Graveyard
|
Daeva
|
Dagon, Dungeon evolved
|
Dah Ork Life!
|
Dai Kin - Naruto Fanfiction
|
Daily Journal of a Workaholic
|
Daily Life of a Bored Archdevil
|
Daily Life of a Pro Gamer!
|
Daily life of An Avenger (An Arifureta Fanfic)
|
Daily Life of Divine Lord
|
Daily Life of Divine Overlord
|
Daily Life of NEET Vampire
|
Daily life of reincarnated goblin
|
Daily life of reincarnated goblin [Dropped]
|
Dainatian Chroniclesm *Hiatus*
|
Dairy of Valerian Laliashili
|
Dakila
|
Damian Dawn in another World
|
Dammit Todd!
|
Damn it, Maria!
|
Damn it, Maria! (Published on Amazon and Paperback edition)
|
Damn! I just want to ask her out!
|
Damn,Now That'S An Adventure
|
Damon's Rache
|
Dan's Shoppe of Oddities
|
Dance of the Phaegon
|
Dancer may
|
Dancing Skulls
|
Dancing, Falling
|
Dandelion
|
Danger Zone
|
Daniel Haley and the Immortal Ninja
|
Daniel Solhoeg (A TWI fanfic)
|
Danimal
|
Danimal - Español
|
Danny Styles and the Thunderdome
|
Dante's Immortality
|
Dantian: The Unforgettable
|
Dao Fang
|
Dao Fang( hiatus)
|
Dao is All-Encompassing
|
Dao Mage : Entity of Magic and Dao
|
Dao of Emperor
|
Dao of Repetition
|
Dao of Zenith Chronicles - Visionary Fantasy with Metaphysical Twists.
|
Dao: Journey to the Top of the Universe
|
Darcy Sparrow and the Spectral Hound
|
Dare ga Oujo-Sama?... Boku?
|
Daredevil : courage and will
|
Dargon
|
Darius Supreme
|
Dark & Light
|
Dark Academy. LitRPG series: Transformation (Book 4)
|
Dark Ashes
|
Dark Avenger: Flames of Hatred
|
Dark Beginnings
|
Dark Blessing
|
Dark blood
|
Dark Bushido
|
Dark Chronicles
|
Dark devourer
|
Dark Dragon King
|
Dark Dungeon
|
DARK EDEN: The Death God's Origin
|
Dark Enforcer
|
Dark Fantasy Short Stories
|
Dark Flame
|
Dark historiën
|
Dark Jokes
|
Dark Lands: The Exile and the Prince
|
Dark Light
|
Dark Lily
|
Dark Lord Dumbledore
|
Dark Lord For Dummies?
|
Dark Lord of Tartarus
|
Dark Lord Saga (Original)
|
Dark Mage: The Offer
|
Dark Memories: Rebirth
|
Dark Memories: Revival
|
Dark Metal Minstrel
|
Dark Mind
|
Dark Moon : Fallen Heart
|
Dark Moon : Rise of The Dark King
|
Dark Night
|
Dark Pathways
|
Dark Rain : Book 1 of The Aetherium Saga
|
Dark Realms Book 1 : Creation
|
Dark Remnant - Injustice
|
Dark Retainer
|
Dark Seas Leading Demise
|
Dark secrets
|
Dark Skies
|
Dark Sky and a New Start
|
Dark Souls
|
Dark souls:Greg's Story!
|
Dark Spine - Envoy of Darkness
|
Dark Star Survivor
|
Dark Storm
|
Dark Thoughts
|
Dark Veil
|
Dark Warlock
|
Dark Weaver: First Apprentice
|
Dark Wind, Icy Snow - (RyuTar, YinYuan) [BL]
|
Dark Wizard's Case. LitRPG series
|
Dark Wolf
|
DarkBoi69's mediocre, rushed and badly-written aventure
|
Darkborn
|
Darkbud's Bloom
|
Darkened
|
Darkening winds
|
Darkest by Day
|
Darkest Entity
|
Darkest Shadow
|
DARKFALL - Volume 1 - Armageddon
|
Darkfall -- Genesis -- Volume 1
|
Darkfall -- Volume 1 -- Armagedden
|
DarkForce: Conquest Expansion 1 (LitRPG Mini-Series)
|
Darklands: Book Three of The Rhenwars Saga
|
DarkLight
|
Darkness
|
Darkness God Shura
|
Darkness in the Heavens (Hiatus/Dropped)
|
Darkness Rising
|
Darkness within darkness
|
Darkness, Silence And Really Bad Breath
|
Darkpawn
|
Darks Rising
|
Darkstorm: Book One of The Rhenwars Saga Preview
|
Darkstory
|
DarkVoid: The God of Death
|
Darkwalker
|
Darkworlds : London
|
Das Neue Vaterland
|
Data Dragon Danika
|
Date of Dawn
|
Dating a Witch
|
Dating my fiancée
|
Dating Trials of a Vampire Queen
|
Daughter of a Dark God
|
Daughter of Fire and Water: Awakening
|
Daughter of the Red Queen
|
Daughter of Yser
|
Dauntless Star
|
David The Gray Mage
|
Davram Who Sings
|
Dawn
|
Dawn Dead (HIATUS)
|
Dawn Guard
|
Dawn of Antiquity
|
Dawn of Darkness
|
Dawn of darkness(ABANDONED)
|
Dawn of Discovery
|
Dawn Of Dragons
|
Dawn of Gaia Online [Dropped]
|
Dawn Of Magic
|
Dawn of Myth
|
Dawn of Pangea
|
Dawn of Ragnarok
|
Dawn of the Abyss: Reincarnation of the Smith
|
Dawn of the Abyss: Return of the Smith
|
Dawn of the Apocalypse
|
Dawn of the Beast Cultivator
|
Dawn of the Eclipse [Foremerly Known as Soul-Bound]
|
Dawn of the Gods
|
Dawn of the megaverse by the great intelligence
|
Dawn of the Realms: Promised Daughter
|
Dawn of the System
|
Dawn Rises
|
Dawn Weaver - a tale of Dragon Riders
|
Dawn_Pour
|
Dawnlands, A New Beginning
|
Day in the life of a _______ (COMPLETED)
|
Day of Wrath [Doom 2016/Eternal rewrite]
|
Day-to-Day Kindred
|
Daybreak
|
DayDream
|
Daydreaming magic swordsman
|
Days in Feyhaven
|
Days of Blood and Roses
|
Days of Blood and Roses: A Magical Girl Thriller
|
Dc Warlock
|
DCO- Dungeon Core Online
|
Dead Circus
|
Dead Copy, Isekai ni Shin no Shujinko
|
Dead Core
|
Dead Count Fifty
|
Dead Dragon's Combat Manual
|
Dead Earth Online
|
Dead Emotion
|
Dead End
|
Dead Fiction Still Here For My Own Cringe Worthy Moments
|
Dead Gods Tell No Tales (Working Title)
|
Dead In Peace
|
Dead in the Water: A Dungeon's Tale
|
Dead Man Division
|
Dead mans tale
|
Dead Men (Duo-OC SI)
|
Dead Men (Duo-OC SI) (Old Version)
|
Dead Rising
|
Dead Soul
|
Dead Tired
|
Dead To You
|
Dead under
|
Dead Universe.
|
Dead World Online
|
Deadlier of the Species - Book 2 of Descendants of a Dead Earth
|
Deadliest Sin, Greed
|
Deadline
|
Deadly Warfare - The War Between Great Nations
|
Deadly Zero HP
|
Deadman
|
DeadZone - Synthesis
|
Deal Breaker
|
Deal With A Maid and A Bartender
|
Deal With The Devil
|
Dealing with a Certain Fox's Antics
|
Deals & Destiny
|
Dear Journal
|
Dearest O'Malley
|
Death and Dandelion
|
Death and Deliveries
|
Death And Disaster And Dungeon World
|
Death Becomes Him: An Age of Steam and Sorcery Novel
|
Death Bringer
|
Death By Crotch
|
Death by Ex-Girlfriend Vol. 6: The Phantom Pain of Rousoku Himawari
|
Death by Ex-Girlfriend: Aika Crisis
|
Death by Ex-Girlfriend: Dawn and Dusk
|
Death by Ex-Girlfriend: Satori Effect
|
Death by Ex-Girlfriend: The Phantom Pain of Rousoku Himawari
|
Death by Ex-Girlfriend: War Cloud
|
Death By Protagonist
|
Death Contract
|
Death Count
|
Death Cultivator (Cultivator in Another World Vol. I & II)
|
Death Cultivator (Cultivator in Another World Vol. I)
|
Death Drive
|
Death Embraced
|
Death Exists Not Under Heaven
|
Death Fantasy
|
Death Galaxy
|
Death God
|
Death God System
|
Death God's Adventure in Another World [Dropped]
|
Death God's Another World Adventure
|
Death God's Descent (DROPPED)
|
Death in Siberia (The Last Woman on Earth)
|
Death Incarnate
|
Death Incarnate (Completed)
|
Death Incarnate (Main Story Completed)
|
Death Is a Reality
|
Death is Just a New Oppertunity
|
Death Is Only The Beginning
|
Death is Pleasant
|
Death Knight
|
Death leads to Godhood
|
Death Lives
|
Death Loli
|
Death Mark
|
Death Note : A New Story
|
Death of Humanity
|
Death Quest
|
Death Streaming
|
Death Theory
|
Death touch
|
Death Visions
|
Death with benefits
|
Death's Companion
|
Death's Crown
|
Death's Dancer
|
Death's Disciple
|
Death's Door
|
Death's Embrace
|
Death's Gate: A LitRPG
|
Death's Heir
|
Death's March to God- Book 1: Cosmic Beauty
|
Death's New Entertainment By Zed019
|
Death's Oracle
|
Death's Son Desire
|
Death, Taxes, and the Second Law of Thermodynamics
|
Death, the Savior
|
Death-Bound Chronicles: The Unlucky Shadow
|
Death-Guard Rejects
|
Death... and me
|
Death? Not even once!
|
Deathgod Chronicles
|
Deathlands
|
Deathless
|
Deathless: The Rise of the Unkillable Demon King
|
Deathly Dawn
|
Deathly Sin: Devourer
|
Deaths Door Online
|
Deaths Usurper *Sorry Done*
|
Deathstars
|
Deathsworn
|
Deathtouched
|
Deathwalker
|
Deathwatch Team Fluff: A Warhammer 40k Story
|
Debacle: A Tale of Tails
|
Debt Star
|
Debts Come Due!
|
Debuff
|
Dec:Ide
|
Decapod
|
Deceiving darkness
|
Deception
|
Decide Your Fate Games - R.Malak
|
Decided not to Kill even if I die
|
Decimating Gods and Demons
|
Decimation [ Apocalyptic Novel ]
|
Decimation Mortism
|
Deck of Cards
|
Deck of Souls
|
DECK: Annoying Dreams
|
Declining Destiny
|
Decoder;Deconstructor
|
Decompose!
|
Deep Ambrosia
|
Deep Delve
|
Deep In The Heart
|
Deep In The Heart (2019)
|
Deep In The Heart 2019
|
Deep Sea Shark
|
Deep Space
|
Deep Space Combat School: Nexus
|
DeepDive
|
Deeper Darker
|
Deepest Desire
|
Deepest Dungeon
|
Deepest Dungeon: Mark and the Lord of Darkness
|
Defender of Lapu-Lapu City
|
Defenders of Fantasmyth
|
Defending Mars
|
Defiance of the Fall
|
Defiance: A Hybrid's Tale
|
Defiant [Epic Fantasy]
|
Defiant Will
|
Defiant: The Bewitched Demon Hunter
|
Definitely Not A Super Tale of A Super Hero
|
Defy the Heavens?
|
Defy the Legends
|
Defying Heavens
|
Defying Souls Gods
|
Defying World Asura
|
Deicide
|
Deities and Mortals
|
Deity of carnage - Keeper
|
Deity of carnage - Unholy Kingdom
|
Deity of the Mist: a Naruto fanfic
|
Deity: The Beginning
|
Dekar as Worlds Traveler
|
Delay of the Demon
|
Delete
|
Deleted
|
Deleted Fiction - Author is Ashamed #3
|
Deleted Fiction - Author is Ashamed #4
|
Deletion Cheat(Dropped/Hiatus?)
|
Deliverance
|
Deliverance of the Mind
|
Delsana
|
Delve
|
Delvers
|
Delvers LLC
|
Dementia
|
Demi-God - A LitRPG
|
Demigod Battle Royale
|
Demise of the Gods
|
Demiurge: The Creator
|
Democracy in Cultivation World
|
Demon Affinity
|
Demon Artificer
|
Demon Bane
|
Demon Blood Chronicles: Emergence (Book 1)
|
Demon Blood: Book I The Arrival
|
Demon Bride
|
Demon Contractor Unknowingly Becomes Less Of A Jerk
|
Demon Dungeon
|
Demon Forever
|
Demon Gf
|
Demon God
|
Demon Heart
|
Demon Hero
|
Demon Hero Reaper Saviour
|
Demon Hunt: Revenge of the Orphaned
|
Demon Hunter Rolland
|
Demon in the magical world
|
Demon into modern human society
|
Demon King 101
|
Demon King is My Husband
|
Demon King Or Immortal God
|
Demon King Reincarnated as the Hero's Child
|
Demon King's Downfall
|
Demon King's end (Inactive)
|
Demon Knight
|
Demon Lord Cthulhu in another world
|
Demon Lord in Angel's clothing
|
Demon Lord in Another World
|
Demon Lord Summoning
|
Demon Lord teaches his son how to deal with Heroes
|
Demon Lord try to be Human
|
Demon lords? Gods? In this Crazy World, I'll fight them all!
|
Demon of Metal
|
Demon of the Darkest Night
|
Demon of the Mind: Cannibal
|
Demon Of War
|
Demon Power Ups
|
Demon Prince Familiar
|
Demon Queen's Life
|
Demon Saga - Phoenix Dancer
|
Demon Slayer: The Kamado Legacy
|
Demon vs. Angel
|
Demon's Country Protector
|
Demon's Journey
|
Demon's Sinistra
|
Demon's Sinistra - Arc 1
|
Demoness in Distress
|
Demonhunter Zecruix
|
Demonic Arts
|
Demonic Descent
|
Demonic Dungeon
|
Demonic Dungeon Uprising
|
Demonic Fire Cultivation
|
Demonic Heroine
|
Demonic Inscriptor
|
Demonic Intervention
|
Demonic Souls of Nature
|
Demonify
|
Demonization
|
DemonLord_Floof - The lack of common sense isekai
|
DemonLord_Floof – A lack of common sense isekai (COMPLETED)
|
DemonLord_Floof – The lack of common sense continues
|
Demonlordchens Symphony
|
Demonology For Morons
|
Demons of Zenora
|
Dennis the Conqueror (Sword & Sorority Book 1), A Harem Lit Fantasy Novel
|
Denouncer of Fantasy
|
Densetsu: A Beautiful Day
|
Denying fate : path of the dark paladin
|
Deployed to Destiny: Elite Force in Another World
|
Deployed to Destiny: Elite Soldier in Another World
|
Depravity and Debauchery in the Southern Kingdoms
|
Depth
|
Depth's of Enhancement
|
Derelict
|
Derelict Beginning.
|
Dergons
|
Descend
|
Descendant of Dawn
|
Descendant Of Nightmare
|
Descendants of Cosmia
|
Descendants of the Divine
|
Descending to Mortal Realm
|
Descent Into Entropy
|
Descent of the Strongest God
|
Descent of Wrath
|
Desert Conquerer
|
Desert Odyssey
|
Desert Wanderer
|
Design of Hope
|
Designation: M4R10N3TT3
|
Desire
|
Desire Dystopia
|
desired ERROR
|
Desires Of Man
|
Desolate Ruler
|
Desolate Stars
|
Desolated World
|
Desperate Hope
|
Despite not Being a Hero, Saint, or Even a Demon King, I was Summoned
|
Despondent Divinity
|
Despotic Heart
|
Destinatus
|
Destined for Talent
|
Destined to Wilt
|
Destiny
|
Destiny Dice
|
Destiny Monogatari: The Hidden Object S1
|
Destiny Online
|
Destiny Roads
|
Destiny's Forge
|
Destiny's Forge (Rewrite)
|
Destiny: Infernal
|
Destiny: Infernal [DISCONTINUED]
|
Destroy The Heavens!
|
Destroy your new life, repair it, destroy it again by doing crazy things while screaming YOLO!
|
Destroying the storyline in Xianxia!
|
Destruction
|
Destruction Angel Summoned From Being Dead For 500 Years Finds Love
|
Detective Karma
|
Detective Karma - The Corruption WIthin
|
Deus Ex Alice Madness
|
Deus ex Aliis Mundi
|
Deus ex Machina
|
Deus Terra: The Land of the Gods.
|
Devastation
|
Deviant
|
Deviant Crown
|
Deviant Crown [Complete]
|
Deviant's Masquerade
|
Deviant's Masquerade: A world of Heroes, Villains, Rogues, and Family
|
Deviant's Masquerade: Huntsman's Quest
|
Deviant's Masquerade: The Anthology Series
|
Deviant's Masquerade: The Huntsman's Quest
|
Deviant's Masquerade: The Huntsman's Quest (A hero's CYOA origin)
|
Deviation
|
Devil
|
Devil Cultivator in a Ability User World (Hiatus/Slow Release)
|
Devil Cultivator in an Ability User World
|
Devil Inside
|
Devil of the Heavens
|
Devil Park Island
|
Devil Princess Reincarnation
|
Devil's Daughter
|
Devil's Doll Reincarnation
|
Devil's Lake
|
Devil's Rise
|
Devil's System
|
Devil's World
|
Devil-Marked
|
Deviled Egg
|
Devils Knight
|
Devils Out of Inkwell
|
Devine Intrusion: The Demonic Repentance
|
Devious Dungeon [Dropped]
|
Devotion Of An Immortal
|
Devour
|
Devour The Cosmos
|
Devour The Heavens
|
Devour the Stars (Blood of the Ruler)
|
Devour: Shiver Online
|
Devourer
|
Devourer (seint)
|
Devourer of All (Blood of the Ruler)
|
Devourer of Destiny
|
Devouring Creation
|
Devouring the Gods
|
Devouring The Heavens
|
Devouring The Universe Begins With Reincarnating As a Snake
|
Dex is for Swordplay
|
Dex Warrior (Libertas Online)
|
Dex's Adventure Through The Elemental Nations (Completed)
|
Dexs/ Clairs Adventure
|
Diabolic Gamer
|
Dial (Ben 10/MCU SI)
|
Diamonds of the Past
|
DiamonFTW's collection of OneShots
|
Diaries of a Fighter
|
Diaries of Nero the Halloween Cat
|
Diary Log of a Ghost
|
Diary of a Dungeon Master
|
Diary Of A Lost Soldier In Another World
|
Diary of a Mad Vampire
|
Diary of a reborn witch
|
Diary of an Insomniac
|
Diary of Discord
|
Diary of Erica Kron
|
Diary of Other-Worldly King: Revisited (R-18)
|
Diary of the Night Demoness
|
Diary of the Shadow Queen
|
Diasori Dynasty: The World's Last Heroes
|
Dice
|
Dice of Infinite Fates
|
Dice, the cube that changes everything: Roll for Initiative
|
Did U Get The Code?
|
Dida: A Living Computer Inside Your Head
|
Didactic Duplicate
|
Didalam Dunia Raja Iblis
|
Died and Went to Manga
|
Different
|
Different Point of View.
|
Different World Along System One Punch Man
|
Different World along with One Piece System
|
Different World Reincarnation God Cheat Harem
|
Different World with Save and Load: A Horror Story
|
Different Worlds
|
Dig a Little Deeper
|
Digging Being Diggory
|
Digging Holes
|
Digimon Empire
|
Digital Demons
|
Digital Haven
|
Digital Immigrant
|
Digital Magical Scientist
|
Digital Marine
|
Digital Me
|
Digital Me - Angels and Devils
|
Digital Sorcery (A LITRPG Adventure Series)
|
Digitized
|
Dilecto the happy skeleton
|
Dim(5,5,5)
|
Dimension Breakers
|
Dimension Eaters
|
Dimension Extra
|
Dimension leapers
|
Dimension Mage
|
Dimension Space - A Dungeon Core Novel
|
Dimensional Break
|
Dimensional Colleseum
|
Dimensional Demonic Phoenix
|
Dimensional Dissonance
|
Dimensional Intersection
|
Dimensional Mage(?)
|
Dimensional Paradise
|
Dimensional Rift
|
Dimensional Wars
|
Dimensions
|
Dimensions intersection
|
Dimensions of love
|
Dimensión Desconocida
|
Dinosaur Reborn
|
Dio, Rise to the top [working title]
|
Dip$h!+s in Space
|
Dipp's Uncertain Adventure
|
Dire
|
Direction and Magnitude
|
Director, Machine, Paradox.
|
Dirge
|
Dirge of Apocrypha
|
Dirge of Apocrypha (Cancelled for rewrite)
|
Dirk, and the Black & Orange Catwomen of Betelgeuse VI
|
Dirt Magic
|
Dirt Magic (HIATUS)
|
Dirty Romance
|
Dis/Connection
|
Disappointing and confusing
|
Discarded Plotline (Discarded Monster)
|
Discidium
|
Disciple of a Demon
|
Disciple of the Dark Arts
|
Disciple of the Dark Arts (Old Draft)
|
Disciple of the Evil God
|
Disciple of the Sword God
|
Disciple.
|
Disciples of the Demon king
|
Disciples of The Strongest
|
Disconnected
|
Discontinued
|
Discontinued-Harems Are Evil!!
|
Discontinued-Legends of Vale Academy
|
Discontinued-The Fox With No Tails
|
Discovering Magic
|
Dishonor
|
Disintegrate
|
Dismissing Darkness
|
Displaced Emperor Conquering The First Universal Plain
|
Distance Between Dimensions: Abandoned God
|
Distance Between Dimensions: Rise of the Summoners
|
Distant Future
|
Distant Kingdoms: Magic War
|
Distant Leaps to Circinus
|
Distant Leaps to Circinus [Obsolete]
|
Distopia of Man - A Dungeon heart story
|
Distorted
|
Distortion: A NPC VS Reality
|
Dive
|
Dive Deep
|
Dive in the Afterdark
|
Dive Sasquatch God!
|
Diver
|
Diverge Summoning
|
Divide and Consume
|
Divine
|
Divine Arts
|
Divine Bladesmith
|
Divine Change
|
Divine Construct
|
Divine Diversions
|
Divine Dragon
|
Divine Dragon [Hiatus]
|
Divine Elementalist
|
Divine Empress of Chaos
|
Divine Entertainment
|
Divine Frontiers
|
Divine Guardian
|
Divine Hell
|
Divine Imperium - Warlord of Takamagahara
|
Divine Inheritance
|
Divine Intervention Online
|
Divine Intervention: Cataclysm
|
Divine Intrusion: The Demonic Repentance
|
Divine Laws of Mind, Body, & Soul
|
Divine Limitless System
|
Divine Locket
|
Divine locket of Hearts
|
Divine Macabre: The Philosopher
|
Divine Man
|
Divine Pagoda Sect
|
Divine Painter
|
Divine Progress
|
Divine Rebirth
|
Divine Salvation
|
Divine Shopper
|
Divine Soul
|
Divine Souls
|
Divine Sparks
|
Divine Time Jewel
|
Divine Valor Online: Against the Heavens
|
Divinity
|
Divinity Reforged
|
Divinity Skill
|
Divinity War - The Rise of the Gods
|
Dixie
|
DIZION: Realm of Mortals
|
Djinn
|
Dk
|
DK (Dropped)
|
Do Dungeons Dream of Goblins?
|
Do I really have no skills?
|
Do Not Awaken The Undead King
|
Do You Ever Wonder How? How This Came To Be?
|
Doc
|
DOC: Northern Light
|
Doctor in Immortal World
|
Doctor of Rebirth
|
Doctor Who: An Alternate Sequel Series
|
Dodge Tank: A Crystal Shards Online LitRPG Novel
|
Dog-King of the Heavens
|
DogZ
|
DogZ (Complete)
|
Doing God's Work
|
Doll
|
Doll of Death
|
Doll's Smile
|
Dolos, god of honesty
|
Domain
|
Domain of Man
|
Domain Of Voids
|
Domain Warz
|
Domains and Daggers
|
DomeNET Online
|
Dominantion of The Greatest Sovereign
|
Domination
|
Domineering Frog King
|
Domini: An Uprising
|
Dominion
|
Dominion Tower
|
Domino Effect
|
Dominus Hunt
|
Don't be Mistaken! I'm not a Reincarnate!
|
Don't Breathe
|
Don't Burst My Bubble
|
Don't Do Hidden Quests
|
Don't Fear the Reaper
|
Don't Feed The Dark
|
Don't Just Eat Everything You Find In Caves!
|
Don't label me!
|
Don't Put All Of Your Short Stories In One Basket
|
Don't read this
|
Don't read this you'll die.
|
Don't Stop Me Now
|
Don't Touch Me, You'll Die!
|
Don't Worry, We Have The Best Supporter On Our Team
|
Dont Know How To Delete So Dropped
|
Doom Guy Isekai
|
Doomed Dungeon
|
Doomed To Be A God
|
Doomsday 2020
|
Doomsday Pillars
|
Door 42
|
Dormir
|
Dots
|
Double Edge Hero
|
Double Rewards for Half the Cost
|
DOUBLE SYSTEM- Path to immortality
|
Douglas Sherman's Journal
|
Doulou Dalu (Soul Land): The 8th Monster
|
Douluo Dalu - Elemental Fire God
|
Douluo Dalu - Hammer God Douluo
|
Douluo Dalu - The Legend of the Poison Emerald King
|
Douluo Dalu Fanfiction: The Journey of Li Tian Tian
|
Dove Clan
|
Down the Deep Blue Hole
|
Down the sewer
|
Down the sewer (complete)
|
Downfall of Mevobak
|
Downfall of the Champions
|
Downfall of the Nanite-Hero
|
Downloaded
|
Dr. Frankenstein's Monster, Lady Lovibond, and the mischievous sea
|
Draconia
|
Draconian System
|
Draconic Blood
|
Draconic Overlord
|
Draconic System Ascension
|
Draconic Transcendence: Cinders and Ashes
|
Dracula: London Calling
|
Dracula: Patient zero
|
Draegish's Light
|
Draegona Chronicles: Crystals of Andromeda
|
Draegona Chronicles: Dragon Warriors of Andromeda
|
Dragged Into a Different World?!
|
Dragged Into An Isekai With My Friend Being The Generic Hero
|
Dragged to another world, I sought independence
|
Dragon Amongst Wolves
|
Dragon and Wolf: Two Brothers
|
Dragon Arts
|
Dragon Ascension
|
Dragon Atlas
|
Dragon Ball Alter: Rise of Little Green!
|
Dragon Ball Magic
|
Dragon Ball System
|
Dragon Ball X The Ultimate System
|
Dragon Ball X: The Ultimate System [Re-Mastered]
|
Dragon Ball, A True Coherent Fan-Fic
|
Dragon Ball: Saga Of The Strongest Human
|
Dragon Ball: Terror of the Gods
|
Dragon Ball: That Time I Got Reincarnated as Nappa
|
Dragon Ball: The RPG.
|
Dragon Ball:RR
|
Dragon Carrier
|
Dragon Child
|
Dragon Child of Thunder
|
Dragon Claw Evolution
|
Dragon Contract
|
Dragon Core
|
Dragon Cross [Old Version]
|
Dragon Cycle
|
Dragon Drudge and Flame
|
Dragon Fairy
|
Dragon Fantasy
|
Dragon Fist
|
Dragon Fragment
|
Dragon God
|
Dragon God Resurrection
|
Dragon Gods Bride ? I think you have the wrong soul ...
|
Dragon Gods king / King of the Dragon Gods : Soaring through whole world
|
Dragon Guardian
|
Dragon Hack
|
Dragon Harem Bulletblade King - Strongest Story on RoyalRoadLegends!
|
Dragon Heart
|
Dragon Heart. Land of Magic. LitRPG Wuxia Saga. Book 6
|
Dragon Heart. Land of Pain. LitRPG Wuxia Saga. Book 9
|
Dragon Heart. Land of War. LitRPG Wuxia Saga. Book 10
|
Dragon Heart. Stone Will. Book I. LitRPG wuxia series
|
Dragon Heart. The Enemy. LitRPG Wuxia Saga. Book 8
|
Dragon Hunter Online (DHO)
|
Dragon in another world
|
Dragon King *FINISHED*
|
Dragon king system
|
Dragon Knight Prophecy
|
Dragon Mage
|
Dragon Mage System
|
Dragon Marksman
|
Dragon Marksman[Short Hiatus]
|
Dragon Master: Monster Taming System
|
Dragon Mastery: Daybreak
|
Dragon Of Coelum
|
Dragon of Lighting and Steel
|
Dragon of Lightning
|
Dragon of the Void
|
Dragon Princess
|
Dragon Princess Reborn
|
Dragon Rising
|
Dragon Rising: The Sixth Apostle
|
Dragon Road: How I Rise in My New Life
|
Dragon Scythe Online
|
Dragon Shifter
|
Dragon Sign: Gold & Glory
|
Dragon Skin
|
Dragon Slaying
|
Dragon Slicer
|
Dragon Sovereign
|
Dragon Spirit
|
Dragon storm: Beginning.
|
Dragon Sword God
|
Dragon Throne
|
Dragon Town
|
Dragon Wars
|
Dragon&Dragons
|
Dragon's Dagger
|
Dragon's Heart. Stone Will. Book I. LitRPG wuxia series
|
Dragon's Regalia
|
Dragon's Rising
|
Dragon's Road
|
Dragon's Roar
|
Dragon's Soul
|
Dragon, Knight
|
Dragon, Silver Dragon
|
Dragon, Silver Dragon; Revelations
|
Dragon: Birth of an Ancient
|
Dragon?
|
DragonBorn
|
Dragonborn Saga
|
Dragonbourne
|
Dragonfall: Enchantment
|
Dragonfall: Soulborn
|
Dragonfather
|
Dragonheart - Dungeon Ritual
|
Dragonic By person
|
Dragonic Evolution
|
Dragonic Evolution [Old]
|
Dragonknight Chronicles
|
Dragons of Dark Rebellion in A World of Essence
|
Dragons Of The Hidden city
|
Dragons Waking
|
Dragons, Seapents and Titans
|
Dragonscale Online Book One: Gilded Dragon Slayer #6
|
Dragonscape Online [VRMMORPG]
|
Dragonslayer: Search For A Golden Dragon (Wings of Fire Fanfiction)
|
Dragoon Isekai
|
Drak's Chronicle
|
Drake
|
Draugr Cell //Layer 01-- Investiture:
|
Draugur
|
Dread Necromancer Of Glyphs
|
Dreaded Duke
|
Dreadful ability
|
Dreadnought - A Superhero Novel
|
Dreadnought: Seeking Freedom
|
Dreadwolf
|
Dream and Death are Synonyms
|
Dream Chaser
|
Dream Connect(Stopped)
|
Dream Dungeon
|
Dream Engineer
|
Dream Game: Fighting for my Desires
|
Dream life!
|
Dream of Eternity
|
Dream of Love, Dream of Hate
|
Dream of the Abyss (renamed)
|
Dream of the Annihilation Girl
|
Dream Online
|
Dream to Dream
|
Dream Weaver ~ The Cursed & The Blessed (Side Stories)
|
Dream Weaver ~ The LightBringer
|
Dream Weaver ~ World Liberation
|
Dream Weaver~ The Cursed & The Blessed ~( Act.1, Act.2, Act.3 )
|
Dream Weaver~ The Cursed & The Blessed ~~( Act. 1 )
|
Dream World Online
|
Dream World Project
|
Dream; Catcher
|
Dreambreaker
|
Dreamer/Leveler
|
Dreaming
|
Dreaming Clouds
|
Dreaming Horizon
|
Dreaming of adventure, I ran away
|
Dreamland invasion
|
Dreams Come True
|
Dreams from the Mingled Earth
|
Dreams of a Lost World
|
Dreams of Dust
|
Dreams of Sabers and Spirits
|
Dreams of the Aasimar Cleric
|
Dreams of the Dying - An Enderal Novel
|
Dreamscape
|
Dreamscape (Working Title)
|
Dreamscape Beta
|
Dreamwalker
|
DreamWorld
|
Drew Nance, Girl Detective Book 01: The Secret of the Old Clock
|
Drew's Story
|
Drezo Regalia
|
Drezo Regalia: Rebirth
|
Drift
|
Drifted Apart
|
Drifter
|
Drifting Clouds, Sheltered Storms (DROPPED)
|
Drip-Fed
|
Drive Time
|
Driver Mach 1
|
Driver: Mach 1
|
Dromadeir
|
Dropped
|
Dropped :(
|
Dropped into a Xianxia World
|
Drops
|
Drugs and Foxtails
|
Druid
|
Druidic Cultivation
|
Druidification
|
Drunk Dungeon
|
Drunken Brawler
|
Drusus The Mighty
|
Druvik
|
Dryad
|
Dryad Relife
|
Dryad the Hero Hunter
|
Du Fyrn Vanyali
|
Du Shaonu : Lady of Darkness
|
Dual Cultivation
|
Dual Nature - A Harry Potter/Percy Jackson crossover
|
Dual Nature - A HP/PJ crossover
|
Dual Rebirth (BL)
|
Dual Soul
|
Dual Soul [Discontinued]
|
Dual Soul Reincarnation
|
Dual Soul Vol.1
|
Dual Sword God
|
Duality
|
Duality of a Soul
|
Duck and Wolf
|
Duel Anthology
|
Dulled Mind
|
Dullest Adventure Ever
|
Dumb Dungeon
|
Dunes of Alkell
|
Dungeon
|
Dungeon - blackjack n' Whooters
|
Dungeon 42
|
Dungeon Academy
|
Dungeon Accident
|
Dungeon Adventure: Let's Party Up!
|
Dungeon AI
|
Dungeon Alive
|
Dungeon and Stars
|
Dungeon Anfoesol
|
Dungeon Annihilation: A Dungeon Robotics Alternative
|
Dungeon Apocalypse
|
Dungeon Architect
|
Dungeon Automation
|
Dungeon Automation (Hiatus)
|
Dungeon Avenger
|
Dungeon Boss Player
|
Dungeon Building For Beginners
|
Dungeon Chef
|
Dungeon City Vanskoria
|
Dungeon Code
|
Dungeon Conqueror
|
Dungeon Conqueror [12+] (On Hiatus)
|
Dungeon core
|
Dungeon Core Abi
|
Dungeon Core and Dungeon Guide
|
Dungeon Core Online: Loremaster (fan fic)
|
Dungeon Core Story
|
Dungeon Core/Realm Heart
|
Dungeon Core: Alex : Hiatuss Infinitetum
|
Dungeon Corps
|
Dungeon Corps - Maze of Menos
|
Dungeon Crawler Carl
|
Dungeon Crawler Carl Book 2: Carl's Doomsday Scenario
|
Dungeon Crawler Carl Book 3: The Dungeon Anarchist's Cookbook
|
Dungeon Crawler Darryl
|
Dungeon Crawler Katia
|
Dungeon Creator
|
Dungeon Cultivator: Fallen Gods
|
Dungeon Delve
|
Dungeon Denizens
|
Dungeon Divided
|
Dungeon Eater
|
Dungeon Ecology
|
Dungeon Engineer
|
Dungeon Games
|
Dungeon God
|
Dungeon Guardian
|
Dungeon Heart
|
Dungeon Hunter
|
Dungeon in a xianxia
|
Dungeon Instinct
|
Dungeon Island
|
Dungeon Isolation
|
Dungeon Item Shop
|
Dungeon Life
|
Dungeon Life: Redux
|
Dungeon Madness
|
Dungeon Mage
|
Dungeon Maker
|
Dungeon maker out of the dungeon
|
Dungeon Maou
|
Dungeon Master in a New World
|
Dungeon Master Life In Another World!
|
Dungeon Mastery
|
Dungeon Merchant
|
Dungeon Misfits
|
Dungeon monster (dropped)
|
Dungeon Oasis
|
Dungeon of Apples? (Completed)
|
Dungeon of Avalon
|
Dungeon of Beginnings
|
Dungeon of Destruction
|
Dungeon of Eternity
|
Dungeon of Horrors
|
Dungeon of Horrors: Flesh and Blood
|
Dungeon of Ideas
|
Dungeon of Immortals
|
Dungeon of Lights
|
Dungeon Of Mass Destruction
|
Dungeon of Night
|
Dungeon of Seasons
|
Dungeon Of Storms
|
Dungeon of the Dark Wilds
|
Dungeon of the Dead [hiatus]
|
Dungeon of the Dead.
|
Dungeon of the Deep
|
Dungeon of The Deleterious
|
Dungeon of the Divine Goddess
|
Dungeon of the Hearth
|
Dungeon of the mindless
|
Dungeon of the Mountain
|
Dungeon of the Northern Lights
|
Dungeon of the Old Gods
|
Dungeon of the Stolen Soul
|
Dungeon Of the Void
|
Dungeon of Trees and Thunder
|
Dungeon of Yanabie Oasis
|
Dungeon Pearl
|
Dungeon Quest Online
|
Dungeon Rails
|
Dungeon Realms
|
Dungeon Researcher
|
Dungeon Robotics
|
Dungeon Runner
|
Dungeon Sect
|
Dungeon Seekers
|
Dungeon Ship (Ash Rising)
|
Dungeon Siege
|
Dungeon Sniper
|
Dungeon Soul
|
Dungeon Spirit
|
Dungeon Story
|
Dungeon System
|
Dungeon Tale
|
Dungeon Tales: Lands of the North
|
Dungeon Tower Babel
|
Dungeon Trope Story
|
Dungeon War: The Rise of Unknown Dungeon
|
Dungeon Wars
|
Dungeon Without A Name
|
Dungeon World Creator Online
|
Dungeon's Ascension
|
Dungeon's Legacy
|
Dungeon's Path
|
Dungeon.exe
|
Dungeon: (Unknown entry)
|
Dungeon: Guy and Two Girls.
|
Dungeon: reaching for her
|
Dungeon: Rise or Fall
|
Dungeonborn - Double Down
|
Dungeons & Demons
|
Dungeons & Monsters
|
Dungeons and Adventurers.
|
Dungeons and Demons inc.
|
Dungeons and Dillholes
|
Dungeons and Dim Hallways
|
Dungeons of the Abyss and the Unchosen Heroes
|
Dungeons, Dungeoning, and Duty (On Hiatus, probably going to be dropped)
|
Dungeons. Why You Might Ask? Because I Can!
|
Dungeonverse
|
Dungeonwars
|
Dunrealm : The Chronicles of the Wanderer
|
Duology Dark
|
Duology: Light
|
Duolou dalu:another story
|
Duplication Gods
|
Durandel Online (DO)
|
Dusk
|
Dusk God
|
Dusk of mythology. *Hiatus*
|
Duskblade
|
Dust
|
Dust to Dust
|
Dust: A Romantic Apocalyptic LitRPG Novel
|
Dusty the Demon (On Hold, possibly indefinitely)
|
Dvati
|
Dwarven Steel
|
Dwarves of Appalachia
|
Dwelling Souls - Story Of A Forgotten Wanderer
|
Dying Dungeons: Dead Kings & Mad Queens.
|
Dying Shards
|
Dying was harder than medical school until someone pushed me down the stairs.
|
Dynasty's Ghost
|
Dysphoria
|
Dystopia
|
Dystopia Against Fantasy
|
Dystopian Dictator
|
Dystopius
|
E
|
E = Magic Squared
|
Each Determined Child
|
Eadenara Online
|
Earth 2.0
|
Earth 402
|
Earth AA
|
Earth Moving Out
|
Earth Sage Doesn'T Want To Be Bothered
|
Earth Tactics Advance
|
Earth to Rae
|
Earth Warriors
|
Earth XIV
|
Earth's Alpha Prime
|
Earth's Core
|
Earth's First Dungeon
|
Earth's Golden Age: The 100 Day Quest, Book 1 - A LitRpg series
|
Earth's Greatest Magus
|
Earth's Hydra
|
Earth's Second Evolution
|
Earth'S Strongest Sorcerer
|
Earth's Uprising
|
Earth: The Gods' Playground
|
Earthen Journey
|
Earthen Lord
|
Earthly Treasures Pavilion
|
Earthly Treasures Pavilion [Discontinued]
|
Earths Eulogy
|
Eat
|
Eat and Grow Strong (Old)
|
Eaten By A Slime?!
|
Eater
|
Eater of Spirits
|
Eating Fast Is My "Overpowered" Ability
|
Eating Fast Is My Overpowered Ability
|
Eating Gods, Becoming Beasts
|
Eau de Toilette
|
Ebon Bolt
|
Ebony Chitin
|
Eburnean Passage
|
Eccentric Soul - Rebirth Into a Fantasy World.
|
Echo
|
Echo Black
|
Echo Of an Empty Soul
|
Echo of Earth
|
Echo of the Hammer
|
Echo Valley (Updates Wednesdays)
|
Echoes
|
Echoes (hiatus)
|
Echoes of Ruin
|
Echoes of Rundan
|
Echoes of the Lost
|
Echoes of the Mirror
|
Echoes of the Past Long Gone
|
Eclipse Online
|
Eclipse Online: [Spoon] the Dimension Thief
|
Eclipse: Rise of a Demon King
|
Eclipse: The Undying Legion
|
Economicalopoly
|
Eczius
|
Edea Chronicles: Hero Summoning Conspiracy
|
Edean World Online
|
Edelinferno
|
Eden Garter, Dragon Anomaly
|
Eden no Sekai
|
Eden Virus
|
Eden: Memories of a Realm
|
Edenawe by Rulpra
|
Edge of Apocalypse
|
Edge of Chaos
|
Edge of Eons
|
Edge of Magic
|
Edge of Reality (Phantom Server: Book #1) by Andrei Livadny
|
Edict
|
Educating E.T.
|
Eein Saga
|
Efatra
|
Eh! Where Did My Pen... Pen... Go!?!
|
Eh? I am Supposed to be Dead But Now I Get a Deadline !?
|
Eidolon : Martial Familiar
|
Eigengrau
|
Eight
|
Eight God Engine
|
Eight steps to the end
|
Eight-Bit Bastards
|
Eightfold Invasion
|
Eighty Year Old Cultivator
|
Eijia
|
Ein Gard
|
Einder Bloodline
|
Einherjar
|
Eir - The Immortal
|
Eirineftís
|
Ekalius Online
|
El Aventurero Maldito
|
El Dorado
|
El Presidente is a dungeon core!
|
El Sexorcisto!
|
Elbard's Uproar(Dropped)
|
Elder Lich Saga
|
Elder Scrolls: Naruto
|
Elder Scrolls: The Master
|
Elder's Game
|
Eldergrove
|
Elderia - Dawn of Creation
|
Eldest Son of the Heavenly Emperor
|
Eldingar - The Lady of Golden Steel
|
Eldritch
|
Eldritch Cultist
|
Eldritch Cultist In Another World
|
Eldritch Maiden
|
Eldritch Night
|
Eldritch overlord
|
Eldritch Rebirth
|
Eldritch Rebirth (Original)
|
Eldritch Rebirth (Rewrite)
|
Eldritch Sorrow
|
Eldritch, Fragments from the Abyss
|
Electric Eastwood
|
Electronic Pulse
|
Electrosilver
|
ELECTUS - A tale of Peaceful Demons.
|
Eleeah
|
Element
|
Element Zero
|
Elemental Artists
|
Elemental Chrysanthemum Homeland Online
|
Elemental Duelist
|
Elemental God
|
Elemental Knights
|
Elemental Monster Tamer
|
Elemental Nations: Oni from the Leaf
|
Elemental Ninjas
|
Elemental Online
|
Elemental School of Hard Knocks
|
Elemental Soul
|
Elemental Sword
|
Elemental Swords
|
Elemental Trinity: A Harry Potter/Pokémon Fusion
|
Elemental Uprising
|
Elemental User in the world of one piece.
|
Elemental Warrior
|
Elemental World Chaos
|
EleMenTaLenT : A Dungeon Keeper's Tale
|
Elementalists
|
Elementals
|
Elementals: Crystal Garden
|
Elementarem Vim
|
Elementia Online: Way of Aer
|
Elementium
|
Elements of Reality
|
Elements of War- Fireborn: The Flames of War
|
Elena from Hell (Volume I)
|
Eleven's Conundrum
|
Elf anew
|
Elf War Online
|
Elgnis
|
Eli
|
Eli's Dream
|
Eliminator
|
Eliona's Gate: Hesitant Healer
|
Eliot Ness for Mayor
|
Elite
|
Elitian XVI
|
Elizabeth the Dark Mage
|
Elizabeth, Elizabeth
|
Elm's Horizon
|
Elrich Saga Yellow Springs Book One
|
Elrich Saga Yellow Springs Book Two
|
Elsa's Journey To The East
|
Elsewhere
|
Elskria Online
|
Elswynd
|
Elten wars
|
Elten wars (Hiatus)
|
Elulra the Elf
|
Elurias
|
Elutheria: Adventures of a Recluse
|
Elven Garden
|
Elves
|
Elycian
|
Elysium
|
Elysium Online
|
Elysium: Diamond In The Rough
|
Emancipation - An Isekai Story
|
Embargo
|
Ember
|
Ember in the Ashes
|
Embers
|
Embers of Nations
|
Emblem Above
|
Embrace of the Ancients
|
Embrace the Blade
|
Embrace the Blade [Drafts 1&2]
|
Embrace the Blade [Dropped/Old]
|
Embrace the Ether
|
Embracing Death
|
Embracing Tears
|
Embracing the world with happiness!
|
Emerald Forest
|
Emerald Skies of Ciel Raven
|
Emerilia
|
Emily Doesn't Die
|
Emily's Diary
|
Emmy And Me
|
Emotionless Pain
|
Empathic capacity of a teaspoon
|
Emperor
|
Emperor (皇帝)
|
Emperor Magus
|
Emperor NPC
|
Emperor of All
|
Emperor of Blue Flower Mountain
|
Emperor of Death
|
Emperor of Heaven
|
Emperor Of Myraid Planes
|
Emperor of Poker
|
Emperor of Soul Pets
|
Emperor Of Space and Time
|
Emperor of the Cultivation World
|
Emperor of the Demon race
|
Emperor Of The End of Times
|
Emperor of the Era
|
Emperor of Yin and Yang
|
Emperor Saga
|
Emperor Saga : Slaves Covenant
|
Emperor's Ascent
|
Emperor's Journey
|
Emperor's Reign
|
Emperor's System
|
Empire at War
|
Empire Building System
|
Empire Haven Online
|
Empire in Crisis
|
Empire of blood and steel
|
Empire of Death Saga: How A Sword changed my Life
|
Empire of Glass - The Heroic Legend of Heron
|
Empire of Salt
|
Empire of Souls
|
Emporium of Awesome
|
Empress is now LIVE
|
Empress of Blue Flower Mountain
|
Empress of the Lost Realm
|
Empress Reborn
|
Empress' Evolution
|
Empress's Emprise
|
Emptiness - The Saga of the Void Hero
|
Empty as tomorrow
|
Empty Promises
|
Empty Promises [Cancelled]
|
Empty Promises [Hiatus]
|
Empyrean
|
Empyrean Ascent
|
Empyrean Blade Kira
|
Empyrean Ice Emperor
|
Emulation of chronology
|
Enable Evolution
|
Enchant Gunner: Bullets and Magic
|
Enchanted: Past, Present and Future
|
Enchanter
|
Enchanting
|
Enchanting Pays Way Better!
|
Enchantress: Pathways Through Darkness
|
Enciclopédia Monstro : Monster musume
|
Encounters Out There
|
Encroaching Darkness
|
End
|
End Boss
|
End of Civilization, First Emperor.
|
End of Days Microfiction Collection
|
End of My Boring Life
|
End of Tales: Gaia
|
End of the Five, Twenty-three, and Twenty-nine Years Story - Wizards of the Otherworldly Court
|
End of the World
|
End World
|
Endborn Creation
|
Endeavor of the Silent
|
Endeavour
|
Ender's Adventure!
|
Ender's Happenings
|
EndGame Online
|
Endless
|
Endless cage(Dropped)
|
Endless Dungeon
|
Endless Expanse Online
|
Endless Fantasy
|
Endless Fight
|
Endless Journey: Infinite Realms
|
Endless Lands
|
Endless Madness: Gods and Ghouls
|
ENDLESS MYTH : Surpassing the Gods
|
Endless Online: Oblivion's Blade (LitRPG)
|
Endless Online: Oblivion's Promise (LitRPG)
|
Endless Path
|
Endless Path : Infinite Cosmos
|
Endless Possibilities
|
Endless Prosperity
|
Endless Samsara, Limitless Nihility
|
Endless Stars
|
Endless Universe
|
Endless Unknown
|
Endless Waltz
|
Endless War
|
Endless Worlds
|
Enemy of The Gods
|
Energon
|
Energy
|
Energy Animals
|
Enganar
|
Enganar - The Watcher's Tale
|
Engine: Online
|
Engineer Army
|
Engraver
|
Enhanced
|
Enhanced!
|
Enigma - Reborn as a Monster into a World of Heroes
|
Enigma's Multiverse
|
Enjoying My Second Life in a Fantasy World
|
Enlightened Empire
|
Enlightenment
|
Enlil, the Immortal
|
Enliven
|
Enor
|
EnRich
|
Enru: Accursed Child
|
Ensis Core
|
Enslaved by the System
|
Ent of Pyromancy
|
Entangled Fates Book 1 - Quantum Beginnings
|
Entangled Superposition
|
Enter Darkness
|
Enter the Storm
|
Enter the System
|
Enter The Warlock
|
Enter: Annwyn Online
|
Enterria
|
Entertainment Cafe
|
Entferner
|
Enthralled: Book 1 - The Crystal Heart
|
Entity
|
Entity(dropped)
|
Entries and Logs.
|
Entropy
|
Entropy (Formerly: Who exactly Am I?)
|
Entropy Summon
|
Entropy Summon (LITRPG)
|
Entropy's Servant
|
Envy
|
Enyatta; Daughter of the Library
|
Eon V
|
Eoum: The Tenth Summon
|
Ephemeral Cycle
|
Ephemeral Shards
|
Ephemeral World
|
Ephemeral: A Journey of Souls
|
Epic of Caterpillar
|
Epic of Esloria
|
Epilogue
|
Epiphany of the Weak
|
Epiphany Online
|
Episode 01: Enter Annwyn Online
|
Epitaph of Everything
|
Epoch
|
Epoch of Humanity
|
Equilibrium
|
Equilibrium (Crypto)
|
ER Vol. 1: Emergency Rabbit
|
Era of Creation
|
Era of Genocide
|
Era of Mutants
|
Era Of The Kobold
|
Erased
|
Erased Existence
|
Eraw : The secret raven
|
Ercse0
|
Ered Kilmah, Overlord
|
Ereidien
|
Eretriah online. A LitRPG book.
|
Ergon V
|
Ericverse
|
Erika's musings
|
Eringer
|
Ero Dungeon Evolution
|
Ero Dungeon Evolution (RR Edition)
|
Eros Libera
|
Erroneous Quest
|
Error
|
Error's Game
|
Erthen Chains
|
Erwin Siegmar
|
Escape
|
Escape - A novella set in the universe of The Net
|
Escape from Idiocia
|
Escape from the Dungeon
|
Escape From ZAN YIDEA
|
Escape The KNIGHT
|
Escape the Room Game #1 - The Bedroom
|
Escaping Ettanward
|
Escaping the Box
|
Escaping the System: Avoid Death at all Costs
|
Escaping Their Grasps
|
Escapist
|
Eshra
|
Eskion -god of all
|
Esoteria: The Planes of Man
|
Esoteric Skeleton Dungeon Master
|
ESP Escapades
|
Esper
|
Esper In Magical World
|
Esper Online: The 15 Thrones
|
Esper: Search for Power
|
Espers
|
ESPU:Zero
|
Essence of Ash
|
Essence of the Dragon
|
Essence of the unRaveled
|
Essence Weaver
|
Essense Weaver: Monster Mage
|
Essentia Animus
|
ESTUD - Exploration, Study, Trials, Upheaval and Discovery
|
Esyr, the First Fae Dragon
|
Et Non Lucem
|
Eterna's Source
|
Eternal
|
Eternal : Bloodborn
|
Eternal Awakening [LitRPG] [EtA Book 1]
|
Eternal Battlegrounds
|
Eternal Beloved
|
Eternal Bones
|
Eternal Champion Book 1: Divine Diversions.
|
Eternal Chronicles: Vampire
|
Eternal Conflict
|
Eternal Demon
|
Eternal Divinity
|
Eternal Dream
|
Eternal Fantasy
|
Eternal Freedom
|
Eternal Harvest
|
Eternal Horizon
|
Eternal Ice Mistress
|
Eternal Kingdom : A Gift From A Loving Brother in A VRMMO World
|
Eternal lord
|
Eternal Lullaby
|
Eternal Magneta
|
Eternal Mana
|
Eternal Pact *DROPPED*
|
Eternal Payment - Angelic Guns and Magic
|
Eternal Peace And Chaos
|
Eternal Pheonix
|
Eternal Plunderer
|
Eternal Regalia
|
Eternal Saga : Book One - The Beginning
|
Eternal Soul
|
Eternal Succession
|
Eternal Teacher
|
Eternal Wind
|
Eternal Worlds : Auto System
|
Eternia Memories: 1
|
Eternia Memories: 2+X
|
Eternia Rising : Lost
|
Eternity
|
Eternity Online, a military sci-fi GameLit Fiction
|
Eternity Wars
|
Eternity Wars 1.0 (Dead Version)
|
Eternity Wars V1 (Dead Version)
|
Eternity Wars V2
|
Eternity's Prophet
|
Eternity's Wake
|
Ethan's Shield
|
Ether Flows
|
Ethereal Bodies
|
Ethereal Creator of Realms
|
Ethereal Heavens: Genesis
|
Ethereal Reality
|
Ethereal Sovereign
|
Ethereal Space
|
Ethereal's 13 Worlds
|
Ethos - a KTS novel
|
Ethria: The Pioneer, An Epic LitRPG Adventure PROMO
|
Etryria [discontinued]
|
Ett Tu Tre
|
Eulalia's Adventure
|
Euphoria
|
Euphoria [DISCONTINUED]
|
Eusocial
|
Euterpe Online
|
Evangeline
|
Eve of Gods
|
Eve to Eternal
|
Even a Hero Needs a Vacation Every Now and Then
|
Even if the World is Against Me
|
Even in the afterlife, I still hate mondays ...
|
Even the heavens will shudder
|
Evenfall
|
Evening Shadows
|
Event Horizon
|
Event Horizon (S5)
|
Ever After
|
Evera: Mourner's Isle
|
Evera: Mourner's Isle [HIATUS]
|
Everdell: A Critters Tale
|
EVERFIRE Online
|
EverLast(Stopped)
|
Everlast: Righteous (Names are Earned, book 1)
|
Everlasting Soul
|
Everlasting Struggle
|
Everlasting Throne of Supremacy
|
Everlasting World Creator
|
EverSense...Offline?
|
Everworld
|
Every Grain of Sand - The Shivered Sky Part 1 - A tale of the war between the angels and demons
|
Every Hero's Thorn
|
Every Hero's Thorn (Hiatus)
|
Every Planet We Reach Is Dead
|
Every Time I Sleep, I Die
|
Everybody here is a cultivation idiot.
|
Everybody Loves Large Chests
|
Everyday Dimensional Amnesia
|
Everyday Life As A Prison Guard
|
Everyday Life As the Demon Prince
|
Everyday Life with Raptors
|
Everyday lives of parallel-world cops!!
|
Everyday normal violence
|
Everyone Else is a Fantasy Character
|
Everyone is a Superhero! Apart from me
|
Everyone is my friend
|
Everyone Loves Fluffy Tails
|
Everyone Loves Min-maxing
|
Everyone thinks I'm an NPC
|
Everyone's Lv Zero
|
Everything Comes Down to Klaus
|
Everything is Worth Killing: Isaac's Tale
|
Everything Needed to Build a Fantasy World in Countless Easy Steps
|
Everything will be my way!
|
Everything's Price
|
Evil devouring slime
|
Evil Dragon on Paper
|
Evil Genius: Ascendance
|
Evil God Mafia
|
Evil God Slayer - Vampire Lord
|
Evil Goddess System
|
Evil Incarnate
|
Evil Overlord: The Makening
|
Evil Overlord?
|
Evil Star (Grave of Heroes Book 1)
|
Evil Tree
|
EvilLive
|
Evo-Gaming
|
Evo:lution online
|
Evocatus
|
Evolution (Rewrite)
|
Evolution Arts
|
Evolution Barricade
|
Evolution God
|
Evolution of a Ball of Light
|
Evolution of a Cultivation Beast
|
Evolution of a dungeon lord
|
Evolution of the Lazy Gamer by Bruticus
|
Evolution of the Living
|
Evolution of the Skeleton who walked alone in a Dungeon
|
Evolution System
|
Evolution System+Customisation System=Stronger System? Maybe not though...
|
Evolution's Choice
|
Evolution- From the Bottom to the Top
|
Evolution-From the Bottom to the Top
|
Evolution-revolution ! ( On Hiatus.... I will never give up... just need time. )
|
Evolution. Starting point: Worm
|
Evolutionary Prison
|
Evolutionary Slime (Dropped)
|
Evolutionist
|
Evolve
|
Evolve and Adapt
|
Evolve or DIE !!
|
Evolve, Adapt, and Kill.
|
Evolve: The Scourge Wars Book 1
|
Evolved
|
Evolved: The Apocalypse of White Light
|
Evolving Unyielding Infestation
|
Ewan story
|
Ex Machina (Hiatus)
|
Ex-Angel
|
Ex-Crown Prince favors the Villainess
|
Ex-mob boss in another world
|
EX: Emblem
|
Exalted Immortal Emperor
|
Exalted Toxin Lord
|
Exalted Warlock
|
Exceed System
|
Exceed System: The Gambler
|
Exceptional Normalcy (A Pokemon Fanfiction)
|
Excitement Turned Real
|
Excursion
|
Excursion Book 1, The Goblin Curse. First arc.
|
Execute Order D20
|
Executioner
|
Exeria
|
Exhuman
|
Exile Online
|
Exiled Nomads of the Galaxy
|
Exiled to a desolate world
|
Exiles
|
Existance Saga: Charlie Foxtrot Zero
|
Existara
|
Existence
|
Existence of The Irregular 2 - Reincarnation
|
Existence Saga: Charlie Foxtrot Zero
|
Exitium (dropped)
|
Exodus: The Assassin's Path
|
Exodus™ Online by B4DDI3Z
|
Exoglot [0] //Broken Worlds
|
Exoglot [0] The Sinner Sky
|
Exorcism 101: Where Love can Cure Ghost Possession
|
Exosolar
|
Exousia
|
Expanse
|
Experia Online
|
Experiment
|
Experimental Dungeon Novel
|
Experimental human in the new world
|
Experimental Omnipotence
|
Experimental Princess
|
Experimental Wuxia Novel
|
Exploit
|
Explore, Search, Hunt
|
Exponential Mana Regeneration
|
Expressionless?
|
Exrenity
|
Extant Expanse
|
Exterminator Dungeon
|
Exterminus - Restart
|
Extinction
|
Extra character at irregular magic highschool
|
Extra Life Online
|
Extrasensory Perception System (EsPers)
|
Extreme Heights: Face Your Fear
|
Extreme Sports!!
|
Exubera
|
Exuperius
|
Eye from the sky: The Journey of Thaim
|
Eye of Adventure
|
Eye Of The Eclipse
|
Eyes Full of Sins
|
Eyes of Eunos - a Kammi Kettu story
|
Eyes of passion
|
Eyes of the Asura: A Superhero GameLit
|
Eyes of the Asura: A Superhero's Tale
|
Eyes of Time: New World
|
Ezekiel, an Angel in the multiverse.
|
Eztiren
|
F**k Me! Hate Me!
|
F-Ranked Cultivators in an F-Ranked School
|
F:Ran
|
Fables: The Forgotten Legends
|
Facade
|
Face your Fate
|
Faceless Phantom
|
Faceless: The Monster Within
|
Facet Fatalis
|
Facilities and monstrosities
|
Facticity
|
Factions at War
|
Faded Grey
|
Faded Hours
|
Faded World: The Island
|
Faeos Book One: The Stuff of Legends
|
Faerwald - Rise Above
|
Faery Knight - A Mirai Suenaga Adventure
|
Fafner the greedy dragon
|
Failed Creation
|
Failed Dungeon Inn
|
Failed Hero
|
Failed Suicide
|
Failed World
|
Fair Princess
|
Fairy Godmother Inc. (Apollo's Angel- Book 1)
|
Fairy Hunt
|
Fairy Knights
|
Fairy Tail highschool
|
Fairy tail Star Dragon
|
Fairy Tail: Fubuki
|
Fairy Xia Yu Manual Pampering the Beautiful Harem
|
Fairy-Elf Enigma
|
Fairytale of Mine
|
Fais Toi Plaisir
|
Faith | Blurry Lines
|
Falcon Punch
|
Falene Fantasy: The Undying
|
Falgreys
|
Falknir - Rising From Ashes
|
Fall For Me
|
Fall From Grace - The Prequel
|
Fall From Grace.
|
Fall of Jupiter
|
Fall of Man
|
Fall of the Seven Kings
|
Fallacy of Fate
|
Fallen
|
Fallen Apostle
|
Fallen Ash
|
Fallen Celestial ~ Traveler Of Worlds
|
Fallen Crow
|
Fallen Divine Online
|
Fallen Earl ~ Hidden Boss Capture Target
|
Fallen Eleven
|
Fallen From Grace - Blood Beginnings - Book 1
|
Fallen from Heaven
|
Fallen from the Moon
|
Fallen God decides to live a little
|
Fallen Immortal
|
Fallen Kingdom
|
Fallen Star
|
Fallen star - A Dragon's tale
|
Fallen Throne
|
Fallen World (The Dark Enemy)
|
Fallen Worlds
|
Fallen Worlds: King's Rule
|
Falling
|
Falling from Earth
|
Falling From Grace, With Style
|
Falling in Love : I love you, Today and Forever
|
Falling in love with a witch
|
Falling in Love with The First King
|
Falling in Love with The First King - Draft
|
Falling into Crazy!
|
Falling Petals
|
Falling rain
|
Falling Star of Evolution
|
Falling Stars
|
Falling Upwards
|
Fallout: The Gamer
|
Fallsinkplummet;
|
Falnen
|
False Dendrite -heaven shouter-
|
False Fate
|
False Poems
|
False Prophecy
|
False Prophecy (Prelude)
|
Familia: Ang simula
|
Familiar
|
Familiar In Chains
|
Familiar Things
|
Familiar's Chronicles
|
Family (Omniscient Reader's Viewpoint Fanfiction)
|
Family business
|
Family Matters
|
Family of abnormalities
|
Family of Fiends
|
Fanfic Ideas
|
Fang the Iron Chef
|
Fangs
|
Fantasia
|
Fantasia Online [VR Game]
|
Fantasia Saga - Book 1: Rise of monsters
|
Fantasia-The story of the Willful Wolf
|
Fantasia: Red Dawn (Old Version)
|
Fantasia: Red Dawn (Rewrite)
|
Fantasia: The odyssey of magic
|
Fantasial Apocalypse
|
Fantasial Rise
|
fantasial rise [HIATUS]
|
Fantastic Advancement
|
Fantastic Darkness
|
Fantastic Journeys Through the Stars
|
Fantastika Ultimata: Royal Soul
|
Fantasy and Terror Klepto's Harbinger
|
Fantasy Annihilation
|
Fantasy Collision
|
Fantasy Craft Online: Donny Opens a Strip Club in Another World
|
Fantasy fugitives (Hiatus)
|
Fantasy Hitman
|
Fantasy In A Turtle's Shell.
|
Fantasy Inbound
|
Fantasy into Fallout
|
Fantasy Mecha Online
|
Fantasy Mecha Online (Cancelled)
|
Fantasy Online: Hyperborea
|
Fantasy Road Trip
|
Fantasy Royale
|
Fantasy Unlimited (Dropped)
|
Fantasy Vs Technology
|
Fantasy war
|
Fantasy wishes
|
Fantasy World Adventures
|
Fantasy world Domination
|
Fantasy World Epsilon 30-10
|
Far Behind
|
Far Strider
|
Faraway land
|
Farblade
|
Farm Life
|
Farmer From Hell
|
Farmer of all Trades
|
Farmer's Dungeon
|
Farming For Gold
|
Faroutposts
|
Farseer
|
Fast Food in Another World
|
Fat Boy Hero
|
Fatal Chapters: A Guide to Piloting Gods
|
Fatal Cries
|
Fatal System
|
Fate
|
Fate - Led journey in Mythical World
|
Fate and Chance
|
Fate Cannot Bind Me
|
Fate CON-trol
|
Fate Destroyer
|
Fate Epsilon
|
Fate of a villain
|
Fate of Maggot
|
Fate of Souls
|
Fate Of The Swordsmen
|
Fate Online
|
Fate Online (The Demonborn)
|
Fate Overcharge (Stalled)
|
Fate's Assassin *dropped*
|
Fate's Choice (ABANDONED)
|
Fate's Fortune
|
Fate's Slave
|
Fate/Negative
|
Fate/Regalia
|
Fate/Resurrection
|
Fate/Reverse
|
Fate/Survivor
|
Fate: A Short Story
|
Fateburn: Chaos uploaded(ABANDONED)
|
Fated
|
Fated Realms: A Tale of Two Siblings (Working Title)
|
Fated Sword
|
Fates Parallel
|
Fath dungon
|
Father at 15
|
Father of Monsters
|
Fathers Bury Sons
|
Faulted Perfection
|
Fayde of the Void (OLD VERSION)
|
Fayde of the Void: The Immortal King
|
Fayte
|
Fear and Forgiveness(A Collection of Dark Tales)
|
Fear and Forgiveness(A Complete Collection of Strange Tales)
|
Fear Rune - The Abandoned Realms
|
Fear system
|
Fear the Netherlands
|
Fear the wrath of the spider
|
Fear-Driven (Give and Take Part 1)
|
Fear: Ever-Changing and Evolving
|
Fearless
|
Feathery Delight
|
Fedora/Katana
|
Feed The Hunger
|
Fei Cai's Ascension— Reverend Insanity
|
Fei's prophecy
|
Feirut's One-shots
|
Felice Hybrid
|
Felicia's Second Life
|
Felicitas
|
Fell Deeds
|
Fell down into a dungeon
|
Female Immortal's Return to Earth
|
Female mage, a Baker, and a kingdom
|
Female Martial Empress
|
Femalekind
|
Femalekind Book One (Complete)
|
Femalekind Book Two
|
Femme Fatale - An Element On the Run
|
Fenrin's Tale - a third chronicle of the Children of the Bear
|
Fenrir Rising
|
Feral - Evil is a matter of perspective
|
Feral Shadows
|
Feral: The Story of a Half Orc
|
FeralHeart
|
Fermi Paradox
|
Fever Vine
|
FFO - Free Frontier Online (on hiatus)
|
Fiction
|
Fiddler in Another World
|
Fidget Spinner Cultivator
|
Field of blood
|
Field of Machines
|
Fields of Deceit (Multiverse OC/SI)
|
Fields To Fights
|
Fiends
|
Fifth Dimension
|
Fifth Life: Scarlett
|
Fight the System
|
Fight To Live Another Day
|
Fighter's Journey In Pokemon World
|
Fighting Back The Tide
|
Fighting Fantasy
|
Fighting Fate
|
Fighting for the Lord of Earth
|
Fighting God
|
Fighting to be Kind in a Cultivation World
|
File corrupted
|
File's Cor
|
Filth: Soiled Destiny
|
Filthy Casual
|
Final Boss
|
Final Destiny Online
|
Final Earth
|
Final Hour
|
Final Light
|
Final Monarch
|
Final Quest: Restore The Lost Data
|
Final Rebellion
|
Final Stand
|
Final War
|
Finally a competent lord
|
Finding Destiny
|
Finding Freja
|
Finding Home: The Quest for Knowledge
|
Finding Inner Peace In A Cruel World
|
Finding Magic
|
Finding Stardust
|
Fingertips
|
Finley- Diary Entries
|
Finley- The Lost Prince
|
Finn Cambridge…Pokémon Master?
|
Fiona's Tale - the fourth and final chronicle of the Children of the Bear
|
Firakha - Of Monsters And Gods
|
Fire and Blood
|
Fire and Shadows. Legend of the breaker.
|
Fire Away
|
Fire Breather
|
Fire Emblem: Blazing Sword
|
Fire Emblem: The Lion's Blade
|
Fire Heart
|
Fire in the Blood
|
Fire Lord Seti
|
Fire Mage
|
Fire of a Dragons Heart
|
Fire Rider
|
Fire within
|
Firechaser
|
Firefall
|
Firestorm Monkey
|
Fireteam Delta
|
First
|
First & Last
|
First Academy
|
First Bite
|
First Contact
|
First Contact - Book 1: WarpStar
|
First Death
|
First Galactic War
|
First Love
|
First Of My Kind
|
First RE:Guards
|
First Vampire
|
First Waves
|
First World of an Idle Dreamer
|
Fishing Priest
|
Five Elements Academy: A Tale Of Magic
|
Five Knives
|
Five souls, 1 body
|
Five Squared
|
Fixture in Fate
|
Fjorgyn: A Rebel Rises (Complete)
|
Flags of Rebellion
|
Flame Beneath The Snowfall
|
Flame Heart [Dropped]
|
Flame-Eyed Immortal
|
Flames of Dawn
|
Flames of Divinity
|
Flames Within the Heart
|
Flaming Light
|
Flaming Phoenix
|
Flash Step
|
Flashback: Siren Song
|
Flavour
|
Flawed Teeth
|
Flawsome
|
Fleeting Flight
|
Flesh and Iron
|
Flesh and Metal
|
Flesh runes
|
FLESH: Distorted Soul
|
Fletch!
|
Flick Jumper
|
Flight of Icarus
|
Flight of the Princess Sage
|
Flight of the Princess Sage [hiatus]
|
Flock of Doves
|
Floraling Secret
|
Floriena: The Start of a Journey
|
Flow
|
Flower Fit for a Vampire
|
Flower Girl
|
Flower in Ice
|
Flowered Metal
|
Flowers Before the Dragon
|
Flowers Bloom from Battlefield
|
Flowers change
|
Flowers From a Dark Lord's Fall
|
Flowers on a Broken Path
|
Fluff
|
Fluff-san in the Human World?
|
Fluffy Tails and Horned Heads
|
Fluvia Dellarose was an Otome Game's Villain
|
Fly in Fantasy
|
Fly With Us
|
Flying City of Lavender : Search for the Humanity
|
Fodder
|
Foe of Reality
|
Fog of War
|
Folgore
|
Follow the Reaper
|
Follower Of Death
|
Followers of The Way
|
Folly of Heroes
|
Food Life
|
Food Revolution in the other world
|
Foodie's Enigma
|
Fool's paradise (dungeon novel)
|
Fools of Fate
|
Football System
|
For a Just Cause (Restart Book 1)
|
For Adult Only (FAO)
|
For All In Thy Hands
|
For Glory
|
For Grass and Glory
|
For I Am Legion
|
For I will…
|
For Justice! - A Tale Of Paladins And Hammers
|
For Perverts Only
|
For Queen and Country [An Interactive Novel]
|
For the Hoard
|
For the Man who had Everything
|
For The Right Price
|
For There is Will
|
For Verania!
|
For whatever reason, I seem to have reincarnated.
|
Forbidden Book
|
Forbidden Destiny
|
Forbidden Knowledge
|
Forbidden seduction
|
Force Invasion
|
Force Magician in Another World
|
Force of Change
|
Force of Nature
|
Forced Hero
|
Forced Immortality
|
Forced to be The Villains
|
Forcer By maskdragon
|
Foreigner, Journey in a different Kosmos
|
Foreigner: Journey in a different Kosmos
|
Foreshadow
|
Forest
|
Forest & Human Translator
|
Forest Born
|
Forest Dungeon
|
Forest Dweller
|
Forest of Ore["Orest"]
|
Forest of puns (short story)
|
Forest of Shadows
|
Forest of Teeth
|
Forest Queen
|
Forestborn
|
Foreststorm
|
Forever
|
Forever Alone: Trinity Blade Online
|
Forever at Her Side
|
Forever Beyond Forever
|
Forever Online - Wanderer
|
Forevermore
|
ForeverQuest Online
|
Foreworlds: A LitRPG story
|
Forge of Destiny
|
Forge of Heroes and Legends
|
Forge thyself
|
Forged in Fear and Fury - An Apocalyptic LitRPG
|
Forger of Fate
|
Forgetful
|
Forging a Digital History
|
Forging his own destiny
|
Forging The Beastmen
|
Forgive me, I didn't mean to take that!
|
Forgiven
|
Forgoing Hope
|
Forgotten
|
Forgotten Conqueror
|
Forgotten Dungeon
|
Forgotten Emperor
|
Forgotten Heroes
|
Forgotten Memories
|
Forgotten Necromancer
|
Forgotten One's
|
Forgotten Pages
|
Forgotten Quest
|
Forgotten Realms: Reincarnation of The Devil
|
Forgotten Realms: The Devil
|
Forgotten Reincarnation in another world
|
Forgotten Relic
|
Forgotten Undead
|
Forgotten Weapon of War
|
Fork This Life!
|
Former Demon Lord's Travels
|
Former Ice Princess
|
Forsaken
|
Forsaken Blood
|
Forsaken Core: Awakening
|
Forsaken Earth
|
Forsaken Hope
|
Forsaken Soul
|
Forsaken Talents: A Dark Path
|
Forsaken Warrior - A LitRPG Adventure
|
Forsakendeva
|
Forsaking Reality
|
Fort Geranium
|
Fortress Seven
|
Fortuitous Mage
|
Fortuna in Theatrum
|
Forward is The Day
|
Foundation Master
|
Foundations of Magic
|
Founding Eden
|
Founding of Humanity - Animalist
|
Fountellion in The Spiral (kindle) - The Nature of the Game & Progression One
|
Fountellion in The Spiral - Progression One
|
Fountellion Sessions in The Spiral
|
Four Goblin Brothers
|
Four Miles
|
Four of Fools - The Deck of Fate
|
Four Rhytm Across The Blue DJ - Fly For Once More
|
Four times I've died, the fifth was intentional
|
Fox girl in another world
|
Fox Tail
|
Fox With System
|
Fox-girl Reincarnation
|
Foxes among Wolves
|
Foxglove Fantasy
|
Foxxy girl in another world
|
Fracture
|
Fracture: Tales of the Broken Lands
|
Fractured Horizons
|
Fractured Stars
|
Fractures: A City Asunder
|
Fragility
|
Fragment of Space
|
Fragmented Reality
|
Fragmented Realms
|
Fragments Of Aeon
|
Frame of Mind (Fae Mythos: Gar Darron 1)
|
Framework: Monsters & Legends
|
Framework: Monsters & Legends
|
Frankenstein (of a sort): There Will Be Musical Parts
|
Fratres Per Noctem
|
Frau NoSur
|
Frayed
|
Frays in the Weave
|
Freddie Weasley
|
Free
|
Free Characters For Others
|
Free Empire Online
|
Free Fanfic ideas
|
Free Flight
|
Free To Play
|
Free World Online
|
Free: An Unbound Soul
|
Freedom
|
Freedom : shadow of sins
|
Freedom Fantasy
|
Freedom in the New World
|
Freedom Online
|
Freedom Universe
|
Freedom: Virtual Reality Evolved - (Codename: Freedom Trilogy)
|
Freeform
|
Freelance Saga
|
Freestyle [DROPPED]
|
Fresh Blood
|
Fresh Spawn
|
Freude (Hellsing Ultimate/RWBY)
|
Freya
|
Friction of the Radical
|
Fridays (Continue) Online
|
Friend Of Beast, Enemy Of Man
|
Friend?
|
Friendly Neighborhood Necromancer
|
Friendship Overload
|
Frigid Influence
|
From A Delinquent To A God in 10 Minutes
|
From a Neet, To The Emperor's Wife, To.....Eh, The Demon Overlord?!
|
From a phoenix to a dragon
|
From a World of Fantasy to a VMMORPG
|
From an Endless Time and a Countless distance
|
From Bards and Poets
|
From Beast to Man and Back Again
|
From beyond The Veil
|
From Boy to Man
|
From Chief to the Emperor
|
From Chief to the Emperor (Rewrite)
|
From cripple to hero!
|
From Death I am Reborn: Chaos will Follow
|
From Dreams to Magic
|
From Dreams To Reality
|
From Dust
|
From Earth to Xianxia world
|
From Evil Overlord to NPC Shopkeeper
|
From farm to MMORPG world
|
From Fire: Birth
|
From Fish to Dragon
|
From FPS Game to Another World
|
From God to goblin
|
From gun to sword
|
From My Enemy to My Love (bxb)
|
From Normal Student to Strongest Being
|
From nothingness
|
From One War, To Another
|
From Paladin to Pawn [HIATUS]
|
From RPG-like World to a Xianxia World.
|
From Sanity to Calamity
|
From the Ashes
|
From The Black (dropped)
|
From The Black Abyss: A New Frontier
|
From the Dark, Comes Life
|
From The Earth To The Sky - A Short Story Collection
|
From the Final World
|
From the ground up
|
From the Moon: Home
|
From the Underworld
|
From The Womb Of The Either
|
From Vampire to Paladin
|
Front Tide
|
Frontier Crisis
|
Frontier of Blades and Walls
|
Frontrunners
|
Frost Dragon Cultivation
|
Frost Iron Forge
|
Frostbite - A Kammi Kettu Fan Story
|
Frostfall
|
Frostwell Paranormalcy
|
Frozen Armies
|
Frozen Ascension
|
Frozen in time
|
Frozen Soul (Completed)
|
Frustrated godly gaming
|
FT next gen
|
Fuji
|
Full Breath (Avatar Fanfic)
|
Full Moon at Daybreak
|
Fun and magic
|
Fun in Other Worlds
|
Fun Then Fire
|
Fun With Abduction
|
Fury
|
Fury: Book One of the Titanomachy
|
Fury: Chronicles of the Titanomachy
|
Fused Power
|
Fusion
|
Fusion dungeon
|
Future Magic
|
Futuristic
|
Fuuko: The Fox-Masked Hero
|
Für Elise
|
G.E.A.R - The Study Of Nanomana
|
G.E.S.S. (The phoenix project, book one
|
G.E.S.S. (The phoenix project, book one)
|
G.O.D System
|
G.O.D.S - Great Overlords Dominating Stuff
|
G.O.D.S. : A Gamelit/Xianxia Novel
|
G.R.I.M - This Grim Game Of Ours
|
G.R.I.M - This Grim Journey Of Ours
|
G.R.U.U.U.L
|
Gabriel "The Bastard Son"
|
Gacha System
|
Gachapon!
|
Gaea : A World of Miracles
|
Gaethea
|
Gaia : Legend of Merlin
|
Gaia Ark
|
Gaia Awakens
|
Gaia Campaigner
|
Gaia's little Gamer
|
Gaia's Shield
|
Gaia's will and challenge
|
Gaia- Legend of CC
|
Gaiana: Season One
|
Gaijin
|
Gainers: The chronicles of The Nexus
|
Galactic Fist of Legend
|
Galactic Games
|
Galactic Internet: System Initializing Book 1
|
Galactic Intervention
|
Galactic Privateer
|
Galactic Schizm
|
Galactic Showdown!
|
Galactic Waltz
|
Galal: Horde Master
|
Galataea Crystallim: Chronicles of the Lonely World
|
Galataea Crystallim: Redux
|
Galaxia: A Modern Fantasy! [DROPPED]
|
Galaxy Wars: The Legacy of Light and Darkness
|
Galaxy's Forge - LightHammer Chronicles: Book 1
|
Galbadia Prime Online
|
Gallanor (On hiatus)
|
Gallinus
|
Gambits
|
Gamble
|
Gambled World
|
Gambler's Fallacy
|
Game Change
|
Game Changer - Day Dreams
|
Game Changers
|
Game Cheater Reincarnated
|
Game Makers
|
Game Master - Unlocked
|
Game Master - Unlocked (Terror Infinity)
|
Game Master - Unlocked (Terror Infinity) (Old Version)
|
Game Master - Unlocked [Terror Infinity]
|
Game of apocalypse
|
Game Of Cards
|
Game of Death Gods
|
Game of Hell
|
Game of Reality
|
Game Of Souls
|
Game of the Mad God
|
Game of the Year
|
Game of Thrones FANFIC: Lycan
|
Game Of Thrones: Season 8 - The Right Way
|
Game of World's Heroes
|
Game On
|
Game On!
|
Game Over
|
GAME OVER a daily life of a video game boss
|
Game Over. New Game.
|
Game Over: Rise of the Gods
|
Game Start Cancel
|
Game systems abilities in a fantasy world
|
Game world or A different world?
|
Game, Set, Match
|
Game... Over?
|
Game? Second autumn
|
Gamed:Last Attempt
|
Gamemaster
|
Gamemaster's Adventures in another world
|
Gamer
|
Gamer Girl
|
Gamer God
|
Gamer Kind
|
Gamer of the Dead
|
Gamer of the Dead (Europe Edition)
|
Gamer of the Martial World
|
Gamer of the Martial World [indefinitely postponed]
|
Gamer's Guide to Waking up as a Dinosaur
|
Gamers App
|
Games of Gaia
|
Games of Galdric
|
Gameworld
|
GameWorld: Earth's Apocalypse
|
GameWorld: Genesis
|
Gaming God
|
Gaming King
|
Gaming Paragon
|
Gaming The System
|
Gaming the Tower
|
Ganda'lfr – The Left Hand of God
|
Gangrene: Better Fed Than Dead
|
Gantzer
|
Ganymede Privateer
|
Garden of Ash
|
Garden of Paper
|
Gardener of Immortality
|
Gargoile found the library tower
|
Garth Online
|
Gaslgiht
|
Gast Academy: The Viridian Vipers
|
Gate Between Fantasy
|
Gate Guardian - Song of the Frozen Soul
|
Gate Guardian - Tale of the Blazing Heart
|
Gate keeper
|
Gate of Spirits
|
Gate to Utopia
|
Gate: War of Two Worlds
|
Gate: War of Two Worlds Part 1
|
Gatekeeper
|
Gatekeeper of Death
|
Gates of Doom
|
Gates of the Gamer
|
Gateway
|
Gateway to Nexus (Dropped)
|
Gattican Drive
|
Gears Of Rust (Abandoned)
|
Gecko
|
Gehenna's time ( Hiatus )
|
Geist
|
Gem Wars - The α crystal
|
Gemma Go Home
|
Gems of Fate
|
GemZ: Chronicles of Le'Tayah
|
Gender Bender Superheroines: The Reliquettes!
|
GENE Project: Path to Perfection
|
GENE Project: Road to Perfection
|
General of Darkness
|
General Wife of Dark Emperor: Slow Witted Miss/Droped/
|
General Wife of Dark Emperor: Slow Witted Miss/Dropped/
|
General's Call
|
Generals of the Apocalypse
|
Generation Militia
|
Generation: Alpha
|
Generic Fantasy
|
Generic Isekai Cultivation Wish Fulfilment Power Fantasy
|
Generic System Apocalypse
|
Generic Zombie survival Wuxia Cliche story
|
Generika 0Ffline
|
Genesis
|
Genesis 5.0
|
Genesis Accord
|
GENESIS PRIME- New Beginning
|
Genesis Wave
|
Genesis: Journey of the Creator
|
Geniecide: Genie's First Law
|
Genius has an Infinite Capacity
|
Genjitsu no Kyoukai
|
Genjutsu Made Real
|
Genophage (Liber Telluris Book 1)
|
Genre : Fantasy
|
Genso Suikoden: Worlds Collide
|
Gentle Dragon Edmond
|
Gently Tormented
|
Geo's travels through an unfamiliar continent
|
Geo's travels through an unfamiliar continent V2
|
Geomancer
|
George Brown and the Uth Stones by Duane L. Ostler
|
George of the Dungeon
|
Gestalt Hope
|
Getting a Common Game Ability on Normal Life [Revised]
|
Getting big in the Big Blue
|
Getting Hard
|
Getting isekai'd with my Boy!
|
Getting power IRL is expensive
|
GG Newb- A LitRPG Saga ($200 in prizes! Naming contest!)
|
Ghastly Adventures
|
Ghibli Gang - Where in the world are we?
|
Ghost alchamist's sinister witch [dropped]
|
Ghost Girl, Ghost Girl. She Gonna Take Your Soul!
|
Ghost Gods - Harem Book
|
Ghost of the Uchiha
|
Ghost World Academia
|
Ghost World Academia (Discontinued)
|
Ghost World Academia (Remade)
|
Ghostified City
|
Ghostly Bodies
|
Ghosts in the Dark
|
Ghosts in the Glass-- A Lesser Dark: Book II (Complete)
|
Ghosts in the Glass-- A Lesser Dark: Book II (Second Edition)
|
Ghosts Over the Forest
|
Ghosts Within
|
Ghoul Rising by(Tailspindark)
|
Ghoulish insanity
|
Ghoulish insanity (incomplete/finished)
|
Gi: Imera
|
Giant Eater (LitRPG)
|
Giants and Demons
|
Giantslayer
|
Gift of Mercy
|
Gift of the goddess
|
Gifted
|
Gifted Eyes
|
Gifts From Morpheus
|
GIG: God In Gold
|
Gilded Age
|
Gin: A pint of London's finest (Litrpg)
|
Gina the goblin, Dungeon Extraordinaire
|
Girl Who Survived The Madness
|
Girl with the Golden Eyes
|
Girl with the Golden-Cat eyes
|
Girls, Go Away!/ Baka Koi!
|
Give me a word I'll make a world
|
Glacierwaif Act 1: Homefront
|
Glacierwaif Act II: Crucible
|
Glass Arrows
|
Glass Cannon
|
Glass Cannon - the Search for Synergies
|
Glass Cannons
|
GLASS || The Catalysts Series, #1
|
Gliese
|
Glimmer, A Throne of Souls (An RPG Gamelit Novel)
|
Glints Saga: Dove
|
Glints Saga: Dove – The Story of a Wayward Magical Girl
|
Glints Saga: Papillon
|
Glints Saga: Papillon - The Story of an Ex-Magical Girl
|
Glints Saga: Vanilla
|
Glitch
|
Glitched Amazon; Ghosts Only Die Once
|
Glitchworld Ground Zero
|
Gloam: The Sin-Eater
|
Gloom and Doom: Short Stories
|
Gloomhaven: Glorious Gatherers
|
Gloominess +1
|
Gloominess +4: The Cradle of Gods. A LitRPG series: Book 4
|
Gloria Infidelis -Glory Beyond the Madness-
|
Gloria: A Dungeon Delver's Story
|
Glorius Adventure Online
|
Glory be to Arria
|
Glory Hole Adventure
|
Glory Of The Hunt
|
Gloryhound - The Story of a Wizard's Assistant
|
Gloryland
|
Gluttonous little crow
|
Gluttonous Prince
|
Gluttony
|
Gluttonys Reign
|
Glyph
|
Glóaming of the Gods
|
Gnawing Hunger
|
GNO arms GNO problem!
|
Goal of a Cultivating Beauty
|
Gobbo
|
Goblin
|
Goblin Artist
|
Goblin Combe
|
Goblin Conqueror
|
Goblin Flood
|
Goblin Kingdom
|
Goblin Lord
|
Goblin Mage
|
Goblin Memory
|
Goblin Musicians
|
Goblin Plane
|
Goblin Progenitor
|
Goblin Rebirth
|
Goblin Reborn
|
Goblin Rising
|
Goblin's Evolution
|
Goblin+
|
Goblin: Tower of Gates LitRPG Book One
|
God
|
God Among Men
|
God Among the Cats: Nya Tribe Dominance!
|
God Amongst Cultivators
|
God Blade (Hiatus)
|
God Chef Rordon Gamsay
|
God complex
|
god Dimension
|
God Dragon Emperor
|
God Era
|
God Farmer
|
God in Deep
|
God Is A Game Designer
|
God isn't dead, He's just broke
|
God Killed Me
|
God looking for love
|
God of All Element
|
God of all System
|
God of Chaos
|
God Of Cheat
|
God of Crows
|
God Of Destruction
|
God Of Disaster
|
God of Evolution
|
God of Exemplum
|
God of Eyes
|
God of Gnomes: Book 1 of the God Core series
|
God of Heroes [GoH]
|
God of Infinity
|
God of Magic & Martial Arts
|
God of Magic and Creation
|
God of Martial Arts
|
God of Mischief
|
God of Music
|
God of Nature´s curse
|
God of Sacrifice
|
God Of System
|
God of the Apocalyptic World
|
God Of The Arts Book 1: Captive of Alberdos
|
God of The Criminal's world
|
God of The Crows
|
God of the Isekai
|
God Of The New World
|
God of Virtual Reality
|
God of War in the Cultivation World
|
God of World Creation
|
God Particles
|
God Project : Blank Slate
|
God Rising: The Cult of Ainz Book I
|
God Slayer
|
God Slayer (Vol.1 and Vol.2)
|
God Slaying System
|
God Vessel Online
|
God Yuje
|
God's Adventure
|
God's Beta Tester
|
God's Death
|
God's Descent
|
God's Diary
|
God's Domain
|
God's domain (bodyrefiner99)
|
God's Door
|
God's Eye
|
God's Fall Chronicles: Schism
|
God's fiction (CANCELLED)
|
God'S For Hire
|
God's Gambling Table
|
God's Game
|
God's Game : Player [72]
|
God's Island
|
God's Journey To Be The Best Craftsman
|
God's Little Joke
|
God's Only Child
|
God's Orphan
|
God's Return
|
God's Scale
|
God's Seekers
|
God's System
|
God's Trial
|
God's Trials
|
God's war
|
God's Whims
|
God's wrath
|
God's Wrath: The Dove
|
God, Stop that! Chaos Happened When She Became a He. [Dropped, Has no intention on continuing. The author got job]
|
God-Sent Anathema
|
God-Slayers
|
Goddess at the Gates
|
Goddess of Beauty
|
Goddess of Computation
|
Goddess of Crystal
|
Goddess of Death
|
Goddess of the Anthropocene
|
Goddess of the Sun and Moon
|
Goddess' Slave ∴ Reincarnation
|
Goddesses are out of Heroes, so it's up to Me to Save an Isekai World! [Poll Story]
|
Godefiance: Audun
|
Godfather and Godson
|
Godfather of magical technology with a pinch of exortion
|
Godfather of magical technology with a pinch of extortion
|
GodForge
|
Godfrey the Legend
|
Godhood
|
Godhood Online
|
Godhood: Info Dumps
|
GodHunters
|
Godlea: World of Creations
|
Godless
|
Godlike
|
Godlike Reborn
|
Godling
|
Godlings
|
Godly Otaku Divine System
|
Godly Otaku System: A Gamelit/Xianxia novel
|
Godly Otaku System: A Gamelit/Xianxia novel (Old Version)
|
Godly reincarnation
|
Godly Stay-Home Dad
|
Godly System
|
Godly Voice In Another World
|
Godmaker
|
Godmaker's Gem
|
Godpunk: A Tale of Swords, Sorcery, and the No-Good Journalist Who Saw It All
|
Gods and Creators
|
Gods and Glory
|
Gods and Men: A litRPG Adventure
|
Gods and Worlds
|
Gods Are Watching
|
Gods Be Wary
|
Gods Conqueror
|
Gods Game
|
Gods How I Hate Nature
|
Gods of Space
|
Gods' Game
|
Gods, Monsters, and a Fuzzy-tail
|
Godsbane
|
Godsend
|
Godsfall (Ash Drake Series)
|
Godslayer
|
Godslayer (Krndark)
|
Godslayer (WizOFTime)
|
Godsmith
|
Godstone
|
God´s Games
|
Goes Unpunished
|
Going Against The Ordinary
|
Going Back Into A Distant Past
|
Going Home
|
Going Home (and other day-time delusions)
|
Gokaiku: I Got Reincarnated, But It Wasn't How I Thought It Would Be!!
|
Goku And Saitama'S Ability With Demonic System In Different World
|
Gold 'n Green
|
Gold Inc.
|
Gold Over Gods
|
Golden Age
|
Golden Draconian
|
Golden Dragon's Ascension
|
Golden Fox with System
|
Golden Horde
|
Golem
|
Golem core
|
Golem Power Armour
|
Gone Rogue, Arc I: A Fool'S Errand
|
GoO - Game of Origin
|
Good Demon's War
|
Good Evil
|
Good Game
|
Good Morning World
|
Good or Bad. What's the difference?
|
Gotta Gacha
|
Governor
|
Grace'S Predicament
|
Grahlgar the Ogre
|
Gram Bloodfeast: Retired Warlock
|
Grand Adventure
|
Grand Arcanist: A Warcraft(Fan)Fiction
|
Grand Design
|
Grand Dream Online
|
Grand Fantasia Gates - He who Bled
|
Grand Mage learns to bake
|
Grand Magus
|
Grand Paladin
|
Grand road
|
Grand Summoner
|
Grand Weaver: Renewal
|
Grandma, let's form a party!
|
GrandMaster Dao
|
Grandpa Sweet Fist
|
Grandpa Universe In Multiverse
|
Grandsmith - Art of Forging
|
Granny God-mode
|
Grantale Online
|
Graphomurk
|
Grasping Destiny (Temporary Hiatus)
|
Grasping for the Heavens
|
Gratuitous Item Crafting and Descriptions (and shoddy economics)
|
Grave of Heroes
|
Grave Of The Goddess
|
Graveborne
|
Gravecrawlers
|
Graven
|
Graves
|
Gravestone (Dropped)
|
Gravitas
|
Gravity
|
Gray Color HoC
|
Gray Hour: The Cursed Coin
|
Gray Mage: The Alchemist
|
Gray Wolf.
|
Gray's Crucible
|
Grazing the Sky
|
Great Ascension to Godhood
|
Great Dragon Emperor
|
Great Green Empire
|
Great interdimensional war
|
Great Martial King
|
Great Master of All
|
Great Red Revolution
|
Great sin
|
Great Tyrannical Deity
|
Great War of Cheater! Another World Strategic Warfare
|
Greater Beyond
|
Greatest Gamer (Dropped)
|
Greatest God Li Ma
|
Greatest Superhero
|
Greatest Xianxia Book
|
Greed
|
Green 'n Gold
|
Green Life
|
Green Mountain
|
Green Sky
|
Green Tea Sea
|
Green Tea Sea - A Grand Eye Tale
|
Greenblood
|
Greenskin
|
Greenvale Fairy Tangle
|
Greg Veder vs The World
|
Grey
|
Grey [HIATUS]
|
Grey Eyes
|
Grey Mage
|
Grey Worlds
|
Greyblood
|
Greyblood: Progenitor (A LitRPG Series)
|
Greyskin
|
Grieyes Mages - Unknownly Superior Type Magician
|
Grim Ether
|
Grimdark Ash: Twisted Fantasy
|
Grimm
|
Grimm Darkfyre -- Darkening Dungeon
|
Grimm Lord
|
Grimm, The Mythical Detective
|
Grimmblood Volume 1.
|
Grimoire
|
Grimoire Bound
|
Grimoire Knights
|
Grimoire's Soul
|
Grimoire: Retake
|
Grimsly Elegy
|
Grimstone
|
Grimstone: A Dark Gamelit Western
|
Grimstone: A LitRPG Weird Western
|
Grimy Sunlight
|
Grin the Cheat
|
Grinding in Vast Martial World
|
Grinding Levels on Ossunica
|
Grinding to Become a Protagonist
|
Gris Evighet
|
Grissla the Witch
|
Grocery Bag
|
Grow
|
Grow: A Scourge Wars Web Serial
|
Growing Puppets
|
Growing Strong
|
Growth
|
Guanyin's Journey to the West
|
Guarded
|
Guardian
|
Guardian Heroes
|
Guardian Of Nature
|
Guardian of the Oracle
|
Guardian of Wicked Sphere
|
Guardian Online
|
Guardian Reincarnation
|
Guardians Awakened
|
Guardians by Design - Land
|
Guardians of Midgard: The Legend Begins
|
Guardians Of The Helm
|
Guardians of Times to be
|
Guardians Will Fall, Heroes Will Rise
|
Guardium
|
Guerra Moderna en un Mundo de Fantasía
|
Guess I'm a God now
|
Guess I'm a spy
|
Guidance
|
Guide to Survival in Another World
|
Guiding the Way
|
Guild App
|
Guild of Thieves
|
Guild Wars
|
Guild Wars: Brutality
|
Guilder Story
|
Guildmaster
|
Guilty x Creatures
|
Gun Elf
|
Gun Meister Online 2
|
Gun Meister Online [First Draft Complete]
|
Gun X Princess
|
Gun x Waifu
|
Gunbreaker
|
Gunrunner
|
Gunslinger and Samurai
|
Gur-dun: Grey's Selection.
|
Gura Gura no mi Cultivator
|
Gvera Cross Extras
|
Gwenn Mordredae
|
Gwyn's Pet Life
|
H A L F L I F E
|
H x Alien (Web-Novel)
|
H(e)aven
|
Ha'suru Lab Life!
|
Habitat
|
HacKer;Deep Veiw
|
Hades XII
|
Hai! My name is Satan!
|
Hail Storm
|
Hail The Emperor
|
Hail the King
|
Half a God
|
Half a Heart
|
Half a Step Away from Love
|
Half Breed
|
Half Breed Haven: A Hot Time At The Ol' Lucky Seven
|
Half Demon, half human.
|
Half Dragon
|
Half Mind, Full Legend
|
Half Shaman
|
Half Step
|
Half-Blind Master(temporary title)
|
Halfway to Home
|
Haliel's Adventure
|
Hall of the Immortals
|
Hallowdash
|
Hallowed
|
Halloween Specials
|
Halloweenish Project Time Lapse
|
Halo: Ascendance (Book One)
|
Halo: Spartan-021
|
Halo:Nightstalker
|
Halvard's Chronicle
|
Hammer of Order
|
Hanami
|
Hands Held in the Snow
|
Handsome Glock
|
Handyman
|
Hanging on Bones
|
Hanging out with the Mutants
|
Hangman
|
Hannah Forteza and her Forte Persona
|
HANNIBAL: Season 4 (Book Continuation)
|
HANNYA ' The Curse of Revenge''
|
Hans Pötterman and The Prisoner of Stalingrad
|
Haphazardous Debugging: Adaptation
|
Happiness System
|
Happiness!
|
Happy Dragon
|
Happy Ending
|
Happy Ever After
|
Happy Facility: Origins
|
Happy Fantasy World
|
Happy Happy Fun Time
|
Harbinger of Destruction (an EVP LitRPG)
|
Harbinger of Havoc
|
Harbinger of the Damned
|
Hard Bargain
|
Hard Bargain - Discontinued
|
Hardcore Dungeon Core - A MMAG spinoff.
|
Hardcore Online
|
Hardcore OP-ness
|
Hardcore: Qi Worlds
|
Harder. Better. Faster. Stronger
|
Hardmode
|
Hardwork(a naruto fiction)
|
Harem and Empire
|
Harem In Another World
|
Harem infinity
|
Harem King
|
Harem Reaper
|
Harem Trash: A litRPG Satire that No One Asked For
|
Harems Are Evil!!-REVAMPED
|
Harems are only for wimpy guys?
|
Harmony
|
Harmony: An Assassins Tale
|
HARP;Lunatic
|
Harper's Blues
|
Harrow
|
Harry Gamer (Revamp)
|
Harry Potter - Book 1 - Arrival To The Harry Potter World As a Villain!
|
Harry Potter - Demons in the Sky
|
Harry Potter and The Dark Lord
|
Harry Potter and the Dark Phoenix
|
Harry Potter and the Dark Phoenix [Rewrite in Progress]
|
Harry Potter and the Fourth Member
|
Harry Potter And The Immortal
|
Harry Potter and the Insert of the Self
|
Harry Potter and the Might of Atlantis
|
Harry Potter and the Planar Sovereign
|
Harry Potter and the Wallbanger
|
Harry Potter: and the Book Dweller
|
Harry Potters Second Chance
|
Harry's New Hobby
|
Harry-Stu Gamer by Zed019
|
Hartwright Vampires
|
Haruhism of a Lesser
|
Harukaze 春風
|
Harukaze 春風 V2
|
Harvest Factory ~ a Farmer Life
|
Harvester Wolf
|
Hateful Sin
|
Hatena360: Shira's Story
|
Hater
|
Hatred: The Journey of the Madman [Old]
|
Hattie
|
Hattie: An Old Maid's Adventures
|
Hattoran Chronicle
|
Haunted
|
Haunting Lies
|
Haunting My Boyfriend
|
Have Scythe, Will Travel
|
Haven
|
Haven : Eldritch Knight
|
Haven Chronicles Book One - Eldritch Knight
|
Haven in a Dangerous World
|
Haven in a Dangerous World (Old)
|
Haven seeker: Rogue one
|
Haven: The Sky Scraper
|
Havenbrook [Editing]
|
HavenFall (Thousand Lands)
|
HavenGuarde
|
Having a Common Game Ability In Normal Life
|
Hawkin the Brewer.
|
Hayato the Chibi who became a Great Demon King
|
Hazard Frontier
|
Hazard Lands (Dropped)
|
Hazard Online
|
Hazardous Debugging: Reanimation
|
He Who Came From The Abyss
|
He Who Fights With Monsters
|
He Who Fought The Gods
|
He Who Have Sinned
|
He Who Sits on the Throne
|
He Who Slays by Stevenoth: Discontinued
|
He Whom is Abandoned
|
He's The One™
|
Headpat Bot!!!
|
Headpats
|
Heads Will Roll
|
Heal Die Cry
|
HEAL: In Calamity, Terra & War
|
Healer
|
Healer Prime
|
Healer to Blood Knight
|
Healers Path
|
Healing Luck (Rota Rising Book 1)
|
Hearkened when he was Young (A Roman SI)
|
Heart Cores have hobbies (HIATUS)
|
Heart of a Dungeon
|
Heart of a Mer
|
Heart of a seagull
|
Heart Of A Servant
|
Heart of Borneo
|
Heart of Courage
|
Heart of Creation
|
Heart of Cultivation
|
Heart of Fire
|
Heart of the Dungeon
|
Heart of the Forest (Hiatus)
|
Heart of The Home
|
Heart of the World
|
Heartful
|
Hearth of the mountain
|
Heartless
|
Hearts Of Rust {BL}
|
Hearts Of Rust {Revenge BL }
|
Heartscale
|
Heathens
|
Heather the Necromancer
|
Heaven and Hell
|
Heaven Chronicles: Raven rising (A LitRPG adventure)
|
Heaven Cry
|
Heaven Falls
|
Heaven Immortal Promise
|
Heaven Made Travelar
|
Heaven of the Dream Fantasy - Going for a zero-damage record
|
Heaven Sealing Art
|
Heaven Trial
|
Heaven Vs. Hell: Curse Of The Water Prophet
|
Heaven's App
|
Heaven's Awakening
|
Heaven's Brush
|
Heaven's Cry
|
Heaven's Daughter
|
Heaven's Emergency Exit
|
Heaven's Fall
|
Heaven's Flute
|
Heaven's Grip : Orcs of Iaoue
|
Heaven's Oddity
|
Heaven's Will
|
Heavenly Blood Monarch
|
Heavenly Dao Of The Sword
|
Heavenly Domination
|
Heavenly Goddess
|
Heavenly Hollow Rhapsody
|
Heavenly Mage Shura
|
Heavenly Martial Harmony
|
Heavenly Paragon
|
Heavenly Rebirth - The Martial Hero's Journey
|
Heavenly Sovereign
|
Heavenly Will
|
Heavenly Yang Emperor
|
Heavens and Flames
|
Heavensborne: The Fall
|
Heavenward on Golden Wings
|
Heavy Metal: A Cyberpunk Novelette
|
Hegemon
|
Heidi's Son
|
Heimdall
|
Heinous - The tale of an unusual necromancer
|
Heinous - The tale of an unusual necromancer (dropped)
|
Heir Apparent
|
Heir of Brimstone
|
Heir of Brimstone (A Grimdark Cultivation LitRPG)
|
Heir of Mana
|
Heir of the artificial Gamer system
|
Heir of the Divine Phoenix
|
Heir to a Lost Sun
|
Heir to the Eternal Throne
|
Heir to the Throne
|
Heir's Fate
|
Heirs of Creation- A Supernatural Fanfic
|
Held in the Quiet Night
|
Helden's Keep
|
Heleg en Eryn [ GERMAN / SINDARIN ]
|
Helena's Plane
|
Helix Academy of Superhuman Development — A Superhero Fiction
|
Hell Fighters
|
Hell Knight
|
Hell Knight: Fall of Man
|
Hell Mode Hogwarts
|
Hell of the Dead
|
Hell on Earth [You Decide What Happens]
|
Hell Pawn
|
Hell's Dungeon
|
Hell's Embrace
|
Hell's Finest
|
Hell's Insanity
|
Hell, Sweet Hell
|
Hell-Bound
|
Hellacious
|
Hellborne
|
Hellbound
|
Hellcrashers
|
Heller: New World
|
Hellhound
|
Hellish Ascendance
|
Hello, You're Through To Hades, How Can I Help You Today?
|
Hello..Main Character
|
Hells on Earth
|
Hells Pit
|
Hellspawn
|
Helm.Online
|
Helmer's Theory: A Butterfly Effects
|
Help I'm a Pathfinder Commoner trapped in a Game world.
|
Hemophobia
|
Henchman
|
Her Black Soul
|
Her Fragmented Mind
|
Her God of War
|
Her Highness Only Wants To Train
|
Her New World
|
Her Rage
|
Her Secret
|
Her True Form
|
Herald of the Night
|
Herald of Tomorrow
|
Heralding Fruits
|
Here Be Cowboys
|
Here I Stand (Stand User Si)
|
Here there be monsters
|
Here There Be Pirates: The Dragon and the Bear
|
Here we go again
|
Here's Our Princess, Take Care Of Her! (And Don't Get Killed By The Dragon)
|
HereAfter: Dragons Fall
|
HereAfter: Dragons Rising
|
Heretic King
|
Heretic's Wrath
|
Heretic: Unbound
|
Heretical dungeon
|
Hermit in the woods
|
Hero
|
Hero aiming to be the next Demon Lord concurrent
|
Hero Chronicles:
|
Hero City
|
Hero Demon Synthesis
|
Hero for hire
|
Hero Historia: Jericho Rising
|
Hero Hunter
|
Hero Hunter: A superhero litRPG
|
Hero Hustle
|
Hero In A Monster Academy
|
Hero Is Now Villain
|
Hero Kids Online
|
Hero Land
|
Hero Of Demons (Hod)
|
Hero of Edea
|
Hero of Hsura
|
Hero of Naught (Original edition)
|
Hero of Nierrath
|
Hero or Demon Lord?
|
Hero or Fool
|
Hero or Monster
|
Hero or Villain?
|
Hero Scout
|
Hero Status: Revoked
|
Hero Status: Revoked - Rewrite
|
Hero summoning ?? NO... it's are free soldier summoning !! (Discontinue)
|
Hero's Ballad
|
Hero's breaking
|
Hero's Call
|
Hero's Exodus
|
Hero's Gear Online
|
Hero's Symphony
|
Hero's Tale: A Tragedy
|
Hero's Trouble; How did i end up as Hero?
|
Hero, of the Locus (stillborn attempt, rewriting)
|
Hero:Generation
|
Hero? Again? No Way
|
Hero? I'm assassin, but that's the same right?
|
Hero? Nope I'm their child
|
Heroes & Harmony
|
Heroes & Villains
|
Heroes and Ancients
|
Heroes and Villains
|
Heroes Die First
|
Heroes of Bloodshed
|
Heroes of Erathia
|
Heroes of Errand
|
Heroes of Jorg
|
Heroes of Midlaris
|
Heroes of the Collapsing World
|
Heroes of war
|
Heroes Online - Rosy Undead
|
Heroes Online : Against The Darkness
|
Heroes Return
|
Heroes Wanted
|
Heroes' Burden
|
Heroic Age
|
Heroic Chronicles Volume 2: Dawn of the New Beginning
|
Heroic Necromancer
|
Heroics of an Overlord
|
Heros Of 21st century !
|
Herrscher der Nacht
|
Hestheria
|
Hexarchy
|
Hexarchy: Tainted Earth
|
Hexes for Exes
|
Hey, Hero Killer!
|
Hi Effort Writer
|
Hi, I'm Susan and I drive trucks for the Isekai Dao Displacement Department
|
Hi,I'm Everything.
|
Hidden
|
Hidden Abilities
|
Hidden Adversary
|
Hidden Darkness, a Star Wars story
|
Hidden Deity Of Destruction.
|
Hidden Forge: Lucem Ac Tenebras
|
Hidden Forge: Lucem Ac Tenebras (Rewrite in Progress)
|
Hidden Magics
|
Hidden Sins
|
Hidden Words
|
Hidden World
|
Hidra
|
Hidra- False Hydra story
|
Hierarchy of the Ecumene
|
Hierohn
|
Higanbana
|
High Class Boy... Causes Problems In High School
|
High Crew
|
High God
|
High Lord Calamity
|
High School DEATH GAMES
|
High school life in a world where everyone has superpowers
|
High School of Magic and Weaponry
|
High School with Humans
|
High Skies Piracy
|
High Tides to Low Clouds (ft. Miss Catherine)
|
High-Class Mob
|
High-expectations and haughty thoughts
|
Highborn (The Stormforth Chronicles)
|
Higher Beings
|
Highschool Necromancer
|
Highschool Sweethearts
|
Hightailing It
|
Highway Crooks
|
Hiiro's adventure
|
Hikari Okami: Kitsune Series
|
Hilarity of a Game-Breaking Player [Hiatus]
|
Hilda Finds a Home
|
Hill
|
Him and Her - An Odd(?) Story
|
Him? Her? I am Two, But Two am I [HIATUS/DROPPED]
|
Himitsu the monster guild member
|
Hinterland
|
Hiraeth, longing for a home that never was
|
Hiraeth: Awakening
|
Hiro's Journey
|
Hiro's Predicament (A choice-based novel)
|
Hiro's Tale
|
His Android Wife
|
His Imperial Majesty, the Empress is a Venomous Fairy!
|
His Insanity: Time Traveling in Another World
|
His Lordship
|
His Majesty's Immortal Academy
|
His Whispers
|
History of the Orcs According to, The Beginning: Breath Of War
|
History Repeats
|
History's Strongest Disciple Fanfiction
|
Hit It Very Hard
|
Hit The Road, Jack!
|
Hive - Locked Up In Space
|
Hive Consort
|
Hive Evolution
|
Hive Knight: Trinity of the Hive Book One[Completed]
|
Hive Mind
|
Hive Prince: Trinity of the Hive Book Two[First Draft][Hiatus]
|
Hive Queen
|
Hivemind Overlord
|
Hoard of War
|
Hoarfrost Wintertide
|
Hodgepodge
|
HofN original
|
Hold or Fold: A World Where Wagers Magically Matter
|
Hold the line.
|
Holders
|
Hollow Core: School of Swords and Serpents (Book 1)
|
Hollow Heart Journal
|
Hollow Moon
|
Hollowed Out
|
Hollywood Delight
|
Holocaust Of Saturn
|
Holy Emperor Satan
|
Holy Sword Master
|
Holy World
|
Home Turf
|
Homecoming
|
Homecoming | A Chronicles of Ascension Story
|
Homeward Bound
|
Homicidal Aliens are Invading and All I Got is This Stat Menu
|
Homunculi
|
Homunculus Factory (The Alchemist's Version)
|
Homunculus Factory : My Monster Girl Tower
|
Homunculus Queen
|
Honestly I'm A Good Vampire
|
Honey Bun: Awakening
|
Honey, I'm home!
|
Honor of the battlefield
|
Hooked Up: A Magical Monk LitRPG Adventure
|
Hoopity Scoop: The Duck
|
Hope
|
Hope beyond the Horizon
|
HOPE Engine
|
Hope for Dawn
|
Hope in the Dead - Alone (For you Zombie Lovers)
|
Hope in the Dead - Survive Alone (Zombies)
|
Hope Of Salvation
|
Hope Springs Eternal
|
Horizon
|
Horizon Dawn
|
Horrific
|
Horror Bites
|
Horror from the Depths
|
Horrors Old and Knowing
|
Horsey Ashes
|
Host
|
Host Me!
|
Host, At Least Let the Villains Act First!!
|
Hot Guy Cold Guy
|
Hot Springs Brigade!
|
Hound of War
|
Hound of Ériu
|
House Cazador: Kingdom of the Lion
|
House Denholm's Madman: Raising the Demoness in My Head
|
House Fortino: Village of Steel
|
House Of Crossroads
|
House of Exiles
|
House of Matchsticks
|
House Of Omen: Indomitable Oathbreaker
|
House Of Omen: The Indomitable Smithersmith
|
House of the Dead
|
House of Wolves
|
How a Carpenter became the strongest melee fighter of the New World
|
How a lame loner's life is not like normal dudes
|
How a Skeleton Becomes Sovereign
|
How can I save the world if I'm no longer the hero?
|
How Deep Can People Fall?
|
How Do Centaurs Wear Pants?
|
How do you kidnap a whole school of kids to another world?!!
|
How Do You QA Test a Tsundere Android!?
|
How Does One Become Strong?
|
How Everything Started
|
How I Became A God
|
How I became a monster
|
How I became op.
|
How I Destroyed The Main Questline At My New Job
|
How I escaped being a hero
|
How I got Possessed By A Barrel Of Porn
|
How I got Possessed By A Barrel Of Porn (Paused)
|
How I Rule The World
|
How infinite is infinity?
|
How Is It At Taldora
|
How Much For Your Soul?
|
How Strange, I Seem To Be...
|
How the mighty have fallen
|
How The Weak Live
|
How to "Endure" Living - Putting All Your Points Into STR
|
How to Avoid Death on a Daily Basis
|
How to avoid going insane as a body cultivator
|
How to be a Good Evil Overlord
|
How To Be Human
|
How To Be Successful In Another World
|
How To Beat The Dungeon Boss : Reimagined
|
How to become a Dark Lord
|
How to become a deity
|
How to become a Demon Lord
|
How to Become a Demon Lord in Another World
|
How to Become a Wizard
|
How to become an evil overlord!
|
How to Break an Evil Curse
|
How to Conquer the World
|
How to Create Adventure
|
How to Date an Android
|
How to Fake Your Own Death (Dropped)
|
How to get away with murder
|
How to get lost: a wanderers guide
|
How to get rich in ancient times
|
How To Go To Another World Manual
|
How to God 101
|
How to have fun in an apocalypse
|
How to Join a Cult
|
How to Kidnap your Princess
|
How to Kill an Isekai Protagonist
|
How To Kill Boredom (And The Gods)
|
How to Perform Magic and Influence Fae
|
How to protect a hero
|
How to Run a Demon World: Lesson 101
|
How to Save a Star
|
How to Survive a Summoning 101
|
How To Survive Hell.... Kind Of
|
How To Tame Your Princess
|
How To Tidy Up Loose Ends
|
How To Wear A Crown
|
How To: Think Properly
|
How to:Become an Evil Overlord
|
HOW TO…(now complete with a 'Run Away From Your Death Flags' version!)
|
How We Survived
|
How will the Zenith Rise
|
How Zantheus Fell into the Sky
|
Howling
|
Howling Thunder
|
Howling Wind
|
HP The Birth Of Darkness
|
HRAIN: A StarFighter Story
|
HS Dungeon Crawl
|
Hui Lin: Speechlessly Cultivating
|
Human & [Inhuman]
|
Human Altered
|
Human Hunter
|
Human in a Demon's Hide
|
Human King.
|
Human Nature Never Change.
|
Human Outside, Demon Inside
|
Human Soul
|
Human Spawn
|
Human Weaponry
|
Human: Tower of Gates Book Two
|
Humanity
|
Humanity Extinguished
|
Humanity's Hell
|
Humanity's Last Hope
|
Humanity's Next Steps
|
Humanos x Sistema
|
Humans Remain Wicked
|
Humans: A Mythical Manual
|
Humiliation Of A Samurai
|
Humiliation Of A Samurai (in progress - Chapter 8 coming soon)
|
Hundred Worlds
|
Hunger
|
Hunger for affection
|
Hungry Necromancer
|
Hunt and Heroes
|
Hunt for the ECSS Dark Phoenix
|
Hunter - A LitRPG/Xianxia apocalypse novel
|
Hunter : Surviving in the New World
|
Hunter Markell
|
Hunter Or Huntress
|
Hunter Warrior In Wuxia World
|
Hunter x Hunter: Gon Freecs, The Multiverse Gamer.
|
Hunter X Hunter: Royalty and the World Beyond
|
Hunter's Academy "Aresia"
|
Hunter's Blind [Working Title]
|
Hunter's Bond
|
Hunter's Choice
|
Hunter's Knife
|
Hunter's Log
|
Hunter's Odyssey
|
Hunters
|
Hunters Dream Online: Ascension
|
Hunters Of Reality
|
Hunters of the Night
|
Hunters World
|
Hunting For Hattie
|
Hurt People Hurt People
|
Hush - The Sin of Man
|
Husk
|
Hvn
|
Hy'Ruh-Ha
|
Hybrid Summoner
|
Hybrid's Revelation: Endru's Origin
|
Hybrids
|
Hydar Celestial Imperium
|
Hydra
|
Hymn of Ignis
|
Hymns of Stone
|
Hyperburst
|
Hyphen
|
Hyphen (Pokemon Emerald)
|
Hysteria (hiatus?)
|
Häerandar the elf who is searching for a better life
|
I Accidentally Stole a God
|
I alone fight in the apocalypse
|
I alone live it up
|
I alone live it up - HIATUS
|
I am a Bug
|
I am a Child of Two Celestial Beings
|
I am a Child of Two Celestial Beings (ON HOLD)
|
I am a Fish.
|
I am a genius so I don't need a strong cheat to survive
|
I am a Ghibli System
|
I Am A God Tree?!
|
I am a Guardian in another world!?
|
I Am A Hero: I Believe I Can Fly
|
I Am A Hero: In A Silent Way
|
I Am A Mimic
|
I Am A Spaceship!
|
I am a tree
|
I Am Brand
|
I am but Divine
|
I Am Gamer
|
I Am Gamer Iv
|
I Am God!
|
I Am Going To Die (In This Game-Like Dimension)
|
I am Hulk!
|
I AM Human or Devil
|
I am in the Marvel Cinematic Universe?
|
I am infamous
|
I am Just a Farmer
|
I Am King: Book One (fourth draft)
|
I Am Legend
|
I am My Own Disciple
|
I am my own God
|
I am Not A Hero
|
I Am Not The Main Character
|
I Am Nothing More Than A Mere God, Who Met a Human Woman While Searching For Peaceful Place
|
I Am Npc69
|
I am Ordinary
|
I Am Part Dragon (Part 1 Completed)
|
I Am Power
|
I am Prometheus
|
I Am Supreme (Reloaded)
|
I am System
|
I Am the "God of Death", Whatever That Means. (Original)
|
I Am the "God of Death", Whatever That Means. (Revised)
|
I am the Chosen One
|
I am the Doomsday Weapon
|
I am the firstborn of a new world...
|
I am the king of all villainous villian
|
I am the king of all villainous villian : Volume 1 : against hell devouring beast
|
I Am the Last
|
I Am The Monster
|
I am the pirate gamer
|
I am the supreme evils daughter
|
I am the Villian
|
I am too old for this shit
|
I Am Unstoppable
|
I am Urist
|
I am Urist (Book 1 Done)
|
I am.
|
I am...*sigh* a speck of dust.
|
I Am: Mud Dragon
|
I awoke as the hero of Oakvale
|
I Became a [Biologist] in a Fantasy World!
|
I Became A Building?
|
i became a Girl to win the Tournament
|
I Became a Legend Before I Realized It
|
I Became a Member of my Friend's Yandere Harem?!
|
I Became A MOBA Character
|
I Became A Vampire In Another World
|
I Became A Virtuous Wife and Loving Mother in another Cultivation World
|
I Became An Adventurer
|
I Became my Granddaughter Familiar!? (ReWrite)
|
I Became Rat!
|
I Became the Commander of an Army?!
|
I became the strongest magical tome. But I am still a teacher! Book 1
|
I Became the Villainess, So I Decided to Ignore the Main Characters
|
I Bought Some Guy's Soul On eBay
|
I Came Back In Order To See You
|
I Came, I Ran
|
I can cheat? So let's have fun.
|
I Can Hear Your Thoughts, but it's not like I'm Telling You or Anything!
|
I Can Respawn In The Apocalypse
|
I can skip between worlds!!!
|
I can't activate my mana, so God gave me a system!
|
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic Love-Comedy Light Novel
|
I Can't Believe I Have the Girlfriend of My Dreams! - An Unromantic-Love Comedy Light Novel
|
I can't believe my fiance chose me to be her cheat when she was summoned to another world
|
I can't die but I want to live in excitement...(Dropped)
|
I Can't Own You? (BxB 💙)
|
I Chose Mega Schlong as my Weapon of Destiny, but Everything I Fight is a Male: A Harem Story
|
I Come From The Water
|
I Come In Peace
|
I could be in a coma
|
I Could Have Just Walked Away
|
I Decided To Become A Wandering God; A Record of Adventurous Newly Minted God
|
I decided To Live In This Messed Up World
|
I decided to summon an army of waifus to save the universe.
|
I Decided to Write a Story
|
I didn't actually want to change ♂♀
|
I Didn't Become Super Strong in Another World (Isekai litrpg)
|
I Didn't Even Want to Live, but God Forced me to Reincarnate
|
I Didn't Expect to Wake Up as the Demon Lord
|
I Died
|
I Died & Reincarnated As Wolf In A Fantasy World
|
I Died And Got Reincarnated Into An Isekai World As An Elf With No Mana... But With An RPG System
|
I Died and Reincarnated as a Plant
|
I Died And Was Reincarnated As The Demon King's Daughter?!?!
|
I Died But I Reincarnated As Myself?
|
I died, so I'm trying again with all my stat points put into my Artistry stat!
|
I do whatever I please
|
I Don't Wanna Live My Second Life
|
I don't want to be a hero
|
I Don't Want to be a Hero! But I will fight to Protect my City! (Hiatus)(Might restart soon updated: 2-19-2016)
|
I Don't Want to be Evil, but You're Forcing me to be.
|
I don't want to be Famous!
|
I don't want to be the Hive Queen
|
I Done Goofed A Funny
|
I Enchanted The Whole Forest
|
I Fell And Thus I Must Rise Again.
|
I Flew Into A Fantasy World And Got A Goddess To Use The Internet
|
I Get a Second Chance and Accidentally Become a God
|
I Get A System, But I'm Still On Earth.
|
I Got All The Spells But My Magic Stat Is One So I Became A Stage Magician But Found Out The Doom Spell Doesn't Care.
|
I Got Flown into a Fantasy World and Managed to Convince a Goddess to Let Me Keep a Laptop Connected to the Internet
|
I got nothing (I seriously don't know what to call this)
|
I got reincarnated as a Zerg
|
I Got Reincarnated as High Human with Creation Eye
|
I Got Reincarnated on Earth, Only to Get Summoned Back to My Old World
|
I got Summoned as a Saint with My Own Cheat System.
|
I Got Transported To Dota World with Just 2 shared Tanggos and qualing blade?
|
I got trapped in a dungeon brick
|
I Graduated to become an Ant Queen (Isekai)
|
I Graduated to Become an... Ant Queen?! (Isekai)
|
I Guess I'm An Angel Now
|
I hate being wed in a fantasy world!
|
I Hate Systems
|
I Hate You Master
|
I have a Cat Problem (RWBY Comedy)
|
I Have A Dagger
|
I have nothing
|
I have reach boundless infinity as a good for nothing. Now I want to restart in another world being the ultimate genius.
|
I have the Unique class of "Monster Factory"?[ DROPPED]
|
I Have to Text my Ex, or the World Explodes
|
I Help My Friend Get Together with the Girl I Used to Like
|
i Hunt Mansters?
|
I Just Fell Asleep and Somehow I'm on The Battleship?
|
I just had a realisation recently that I am surrounded by bishies and...
|
I Just Want A Break From This Stupid Tower
|
I Just Want To Eat 3 Meals a Day
|
I Just Want to Live a Peaceful Life!
|
I just want to live, so I will!!!
|
I just want to play alone!
|
I Just Wanted To Die But Instead I Became Immortal
|
I just wanted to fly
|
I Killed Myself but Woke Up in Another World
|
I Know I like Ships but Why did I reincarnate as a Aircraft Carrier?
|
I Live a Funny Life
|
I live in the dark world
|
I Live To Play VR-MMORPG
|
I Lived as a Growing Great Sage with my Fairy Harem in the New World
|
I love this world (Complete)
|
I love you but I'm a boy!
|
I Love You Like An Alcoholic
|
I Loved You
|
I Made One Mistake! Now I Have To Become the Demon Lord in Another World, But I'm Just a Frail Vampire Girl?!
|
I maxed out my Stats, so why am I still a loser?
|
I May Or May Not Have Caused the Apocalypse...? Tee hee~
|
I might be Overpowered
|
I Must Find Light, Or I Will F-ing Die!
|
I Need Healing!
|
I need money to level up!
|
I Need Time
|
I need to repair the gods of a world?!
|
I never asked to be in a rogue-like!
|
I once was named Nguyen
|
I only know Curse Magic!
|
I only tried to change my childhood friend's gender!
|
I only want an ordinary life
|
I Only Wish I Had a Cliché Adventure
|
I reached Godhood by mistake
|
I Reached Reincarnation Limbo Too Early
|
I Read Too Many Light Novels
|
I Really Am An Internet Celebrity!
|
I reincarnated as a baby dragon king!
|
I Reincarnated as a God Working in a Shitty Sweepstakes Call Center
|
I Reincarnated as a Hero's Bad End
|
I Reincarnated as A Little Girl?!
|
I Reincarnated as a Panda
|
I Reincarnated As A System?!
|
I Reincarnated as an Alien Monster
|
I Reincarnated as an Elf in a Broken World.
|
I reincarnated as an octopus - There has to be a mistake
|
I Reincarnated as the Queen, Now What?
|
I Reincarnated As The Universe
|
I Reincarnated in Another World as a Vampire
|
I Reincarnated in Another World as a Woman's .
|
I reincarnated into a bat (Indefinite hiatus)
|
I Reincarnated Into a Fictional Character
|
I reincarnated into a Game called Liberty of Immortals
|
I reincarnated into an op villainess!?
|
I reincarnated... As a human!
|
I reluctantly became the dungeon master
|
I see Kai
|
I Shall Be Hero No More!
|
I Shall Build an Army
|
I Shall Eat Everything
|
I Shall Prevail
|
I shall seek revenge
|
I Shall Stand Supreme
|
I Shall Tame the World!
|
I should have been the Hero instead
|
I Slipped into Another World and Became this Demonic Guy's Pet
|
I somehow became a being that spams to survive unprecedented circumstances
|
I sort of brought Armageddon, but on the bright side, I can go to school!
|
I study magic, for destruction?
|
I Suck At Reincarnations
|
I Summon Ballistics
|
I Summoned You
|
I Survived and Came Back to Apocalyptic Earth
|
I Swear my Brother's the Protagonist of a BL Manga
|
I think i lost my head
|
I Think My Familiar is a DemonLord
|
I Totally Don't Have Anger Problems!
|
I Tripped Over Satan
|
I turned into a little girl after I died?
|
I Unlive and Breath Death
|
I Value Your Clothes More Than Your Life
|
I wanna be a gamer!
|
I wanna be a hero! Beginning of the dark fantasy-
|
I Want a Dragon Waifu!
|
I Want It All - CHANGE!
|
I Want to Be an Adventurer to Defeat the Demon Lord but my Party Members Want to Live a Pampered Life!
|
I Want to Be an Adventurer to Defeat the Demon Lord but my Party Members Want to Live a Pampered Life!(Old)
|
I Want To Becoming A Great Summoner
|
I Want To Die, Let's Isekai!
|
I Want To Live and Enjoy Life!
|
I want to play this deadly game again.
|
I want to restart my world but still have my knowledge and a few cheats
|
I Want to Save the World, but the Goddess tells me to Text my Ex
|
I Want You to Remember Me
|
I Wanted to Play a Strategy Game, But I Became King Instead!
|
I Was a God Until I Got Summoned
|
I Was A Loner, But My Class Got Summoned To Another World And Now…
|
I Was a Teenage Necromancer
|
I was an only child, so I asked God to give me many little sisters when I was reborn
|
I was Bored So I Became The Antagonist In a VR Game
|
I Was Born For Glory
|
I was born the Unloved Twin
|
I was brought in another world as my catgirl avatar.
|
I Was Given A Second Chance, In a World of Fantasy?!
|
I Was Hit By a Truck and Died, but Ended Up Getting the Blessing of a Goddess and Now I am a Trash Healer
|
I was invited here
|
I Was Monster Once, Now I Am Human
|
I was Once the Demon King!
|
I Was Randomly Thrown Into A Game Like World By A Stray Astroid
|
I was reborn as a "Magical"Fairy which can't use magic!?
|
I was Reborn as a Background Character
|
I was reborn as a Cursed Swordman ?! [HIATUS]
|
I was reborn as a demon lord in another world but my morals contradict my title
|
I was reborn as a hybrid dinosaur in Another World
|
I was Reborn as the Villainess but I will become a Great Sage
|
I was reborn in another world with a maxed out speech skill
|
I was reborn into a fantasy world as a magic robot?! Automata Prime
|
I Was Reborn Just To Be Killed?
|
I was reincarnated as a dungeon, that's good, but where are my cheats?!
|
I was reincarnated as a fox in a strange world
|
I was reincarnated as a goblins' slave, became the hero, and now have a harem. "I'm a girl bye the way!"
|
I was reincarnated as a Magic Academy!
|
I was reincarnated as a monster flower
|
I Was Reincarnated as a Prince, but my Kingdom is in Danger from Enemies!
|
I was Reincarnated as a Puddle of Water
|
I was Reincarnated as Bai
|
I Was Reincarnated as Someone's Mana??
|
I was reincarnated into a fantasy world as a woman?!
|
I Was Reincarnated Into A Harem Game As A Villain, Please Stay Away I'm Gay! V1
|
I Was Reincarnated Into Another World As A Fish
|
I was reincarnated into my own unfinished Isekai Light Novel and became apart of the hero's harem.
|
I was reincarnated on the One piece World
|
I was Scum, now I am even more than Scum
|
I was summoned as a Dragon?!
|
I was Summoned as a Hero, but I Became the Demon Lord Instead
|
I was summoned in another world
|
I was summoned to another world without any cheats so I became a villager
|
I was summoned to another world, but i'm a dog!
|
I Was Summoned To Have Tea With The Demon Lord, But Now That I'm Stuck In This Other World, I Guess I'll Defeat Him
|
I was the pet rabbit of a young druid girl in my next life
|
I Was Transported To A Desert Wasteland
|
I who have Fallen
|
I will absolutely cultivate
|
I Will Always Be With You
|
I Will Be Recognized
|
I Will Be The Harem King!
|
I Will Burn Up My Kingdom And Disappear
|
I will create a kemono paradise!
|
I will Kill the Hero! With Fluff!
|
I will not be eaten
|
I Will Pave My Path With Blood
|
I win so they may hear my voice.
|
I Woke Up As A Girl?!
|
I woke up as a mob from a harem anime one day.
|
I won't destroy the world!
|
I Won't Kill Myself for the Second Time
|
I Would be Your Legs
|
I'am not a hero: My adventure in another world
|
I'd Give You Mine
|
I'll be happy as a monster
|
I'll become a villain in my next life
|
I'll become a villain in my next life part
|
I'll do my best to (not)serve you!
|
I'll Kill the Whole World for Them
|
I'll Pay2Win in Another World!
|
I'll try this cultivation thing
|
I'll Wait For You At The Train Station
|
I'm (Sort of) an Expert on Ghosts
|
I'm a 70 years old mage not a little girl
|
I'm a Bat?
|
I'm a Bug in a Fantasy World
|
I'm a Cheater, So What?
|
I'M A Crazy Person Who Jumped In Front Of A Truck To Be Reincarnated Into Another World -On Purpose!
|
I'm A Demon Summoner, Damn It!
|
I'm a girl, but I like another girl?!
|
I'm a God?
|
I'm a Harpy Now I Guess
|
I'm a hero? Nope, familiar
|
I'm a Kitsune?
|
I'm a Man!
|
I'm A Monster, A Harpy
|
I'm A Professional Gamer, So How Did I Become King?
|
I'm A Snaaake
|
I'm a Stingray? (system novel)
|
I'm A Superhero
|
I'm a trash-tier villain in a fantasy dating sim
|
I'm a Vampire
|
I'm a Vampire [ Hiatus ]
|
I'm a wolf but I can level up?
|
I'm a wolf but I can level up? (Discontinued )
|
I'm a zombie
|
I'M Alive!
|
I'm Always Talking to Myself
|
I'm an Alley Cat with a Status Screen
|
I'm an Alleycat with a Status Screen
|
I'm basically a slave with a far too nice master
|
I'm clueless in another world.
|
I'm going to do it! I'm going to reincarnate into a fantasy world and live a great life!
|
I'm Gonna Be A Hero!
|
I'm Gonna Be a Wizard When I Grow up Again!
|
I'm Guilty, My Beauty
|
I'm immortal but my girlfriend is OP
|
I'm in a different world....but I don't mind
|
I'm in a Monster Girl World (MGW)
|
I'm JUST a Farmer NOT an Adventuerer! (Isekai) Light Novel (Watashi wa tada no nōmindeari, bōken-kade wa arimasen!)
|
I'm JUST a Farmer NOT an Adventuerer!!! (Isekai) Light Novel
|
I'm just a mortal
|
I'm Just A Summoner
|
I'm just an 'Ordinary' Human (MCU fanfic)
|
I'm Just the Guard!
|
I'm No Hero
|
I'm Not A Monster, It's Only A Mask
|
I'm Not a Tank
|
I'm Not Going To Let You Capture Me!
|
I'm Not the Demon Princess!
|
I'm Not The Dragon's Mom
|
I'm not the main character.
|
I'm Not The Protagonist?
|
I'm nothing special, so can i go back please ?
|
I'm on TDY from Hell
|
I'm overpowered
|
I'm pretending to be a girl in a MMORPG
|
I'm Raising A Chuunibyou Dragon Girl?!
|
I'm reborn as Sakura... well f*ck my life!
|
I'm reincarnated as the last god?!
|
I'm Reincarnated in Another World but God is an Anime Addict?!?
|
I'm Sorry
|
I'm Still Human
|
I'M Supposed To Be The Hero, So Why Am I A Skeleton!?
|
I'm Sure It'll be Fine! ...right?
|
I'm the bad guy!?
|
I'm the descendant of the Demon Lord!
|
I'm Too Tired of Being OP, So I've Decided to Lives Carefree Lives Instead[BL]
|
I'm... Skeleton A?!
|
I'Minas
|
I've Been Summoned as a Hero ...I'm a God Though
|
I've Reincarnated in another world as a cute fairy
|
I've reincarnated, but I'm a Girl! Wait, am I not even Human?
|
I've Transmigrated... with a Broken System
|
I've waited my whole life for this THE Apocalypse /On hold/
|
I, a Water Snail, accompanying the Immortal Hero
|
I, the CEO have to Farm to Survive?
|
I, The Lightning
|
I, The Maou
|
I, the son of Bloody Mary, have become a king of 6 realms.
|
I.C.O.Y (Bxb)
|
I.R.O.N
|
I.S.E.K.A.I. Squad
|
I:DI/OM - Motherboard
|
I:Dragon
|
Iadral Online: The Final Frontier
|
Ice Cubes
|
Ice Queen By Wi1dBi11
|
Ice Queen in Another World - Volume 1
|
Ice Soulist
|
Icebound Immortal
|
Icy Vendetta
|
Idea Dump
|
Idealism
|
Ideascape
|
Ideascape: An Adventure LitRPG
|
Ideasthesia
|
Identity of the Abyss
|
Identity Undefined
|
Idle Dreamer: First World
|
Idle Immortal
|
Idmon the Skeleton
|
Idol By Laulau20
|
Idol's Road
|
If a Tree Cultivates in a forest and no one is around to stop it, does it make for a good story?
|
If i had emotions, would the world seem more beautiful?
|
If I Have To Be A Dungeon In Another World, I'll At Least Try To Be Fun
|
If I win, will they hear me?
|
If only common sense was a bit more common...
|
If only...
|
If We Cannot Grow Old Together
|
If You Give a Mouse a Dungeon
|
Iferes: Slaves Of The Gods
|
IGNARIS RAY by swey
|
Ignis
|
Ignite (The Fireborn Chronicles Book 1)
|
Igniter, Book 1: Bag Boy
|
Igniting Sparks
|
Ignition
|
Ignius
|
Illicit
|
Illuminated Azure Dragon
|
Illusion
|
Illusion/Core
|
Illusory
|
Ilm.Proxy Isekai
|
Im a Divine Flesh Golem?
|
Im a Kobold, So what
|
Im Going To Another World Even Though Im Not Asian
|
Im in an otome game i know nothing about
|
Imaginary World (The half world chronicles)
|
Imagination Is Creation
|
Imaginator
|
Imagine Dragons
|
Imagining Online: The game
|
Imaginings
|
ImBalence
|
Immense Space
|
Immersion
|
Immersion: Reboot
|
Immoral Cultivator Trump: The Alternative Facts
|
Immortal
|
Immortal Adventure
|
Immortal Anarchy
|
Immortal Apocalypse Marketplace
|
Immortal Ascension Tower
|
Immortal Ascension Tower (OLD)
|
Immortal Chronicles: Quest For Truth
|
Immortal Conqueror
|
Immortal Cultivator System
|
Immortal Demigods
|
Immortal Demon
|
Immortal Dual Sword God
|
Immortal Dynasty (Rewrite)
|
Immortal God of the Blade
|
Immortal in a Mysterious World(Cancelled)
|
Immortal in Another World
|
Immortal Ki Technique
|
Immortal Mage
|
Immortal Martial God
|
Immortal Necromancer
|
Immortal on Earth
|
Immortal on Earth (Dropped, sorry)
|
Immortal Path
|
Immortal Realm
|
Immortal Rebirth
|
Immortal Rising
|
Immortal Shards(hiatus)
|
Immortal Soul
|
Immortal Souls
|
Immortal Sovereign (Cancelled)
|
Immortal Stranger
|
Immortal sword
|
Immortal Swordslinger
|
Immortal Twain Dance
|
Immortal Tyrant in Another World
|
Immortal War
|
Immortal World
|
Immortal's Lament [Dropped]
|
Immortal's Life
|
Immortal's Musings: A Werewolf's Tale
|
Immortalis
|
Immortals: The Curse of Samsara
|
Immortel Evolver Dungeon
|
Immovable Mage
|
Immutable
|
Imoogi
|
IMP-ressively Indecisive
|
Impera
|
Imperator of Beasts
|
Imperator Of Chronos
|
Impersonator
|
Impossible Devices
|
Impostor
|
Imppossible
|
Impractical Magic
|
Improper force
|
IMProvised combat
|
Impulse
|
Impulsive - Descendants of the Gifted
|
Impulsive: Descendants of the Gifted
|
In a different world with the Seven Deadly Sins system
|
In A Different World, But With Friends
|
In a diffirent world with One Piece system. cliche? No it's a cancer cliche
|
In A Distant Past
|
In a medieval world,Why i got a malus instead of a cheat?
|
In a modern world with a game system!!!
|
In a new world, so lets go it alone!
|
In A Parallel World With Random Skills, I Reluctantly Become A Mafia Boss?
|
In a World of Magic
|
In a World Without Coffee
|
In A Wuxia World
|
In another world as a homunculus.
|
In another world as a sim
|
In another world as my waifu #1: Brave New World and the Fallen Prince(ss)
|
In Another World With a God
|
In Another World with Doraemon's 4D Pocket
|
In Another World with my Daughter
|
In Another World With My House
|
In Association with Death
|
In between lives
|
In Between Worlds
|
In dc universe with game system
|
In Harry Potter with OTS System
|
In Heart and Mind
|
In Highschool DxD With My Waifus
|
In Life and In Death
|
In Loki's Honor
|
In Loki's Honor (Rough Draft)
|
In Love with Lightning
|
In Maple Halls
|
In Maple Halls, where Dwarves and Wizards Rest
|
In Memoriam
|
In My Name
|
In my Name as--
|
In New Dimensions Everyday
|
In order to create the Ultimate MC, I became Soldier A!?
|
In Our Image
|
In Our Last Moments
|
In Pursuit of Glory
|
In Range
|
In Spite of it All
|
In That Moment of Suffering
|
In the Aether
|
In the Another World with a Young Body
|
In The Beginning
|
In the City of Wisteria
|
In The Dragon Ball Universe With The Summoning System
|
In The Dragon Ball World with a System
|
In The End
|
In the End the Truth Remains
|
In the eyes of Infinity
|
In the Eyes of Others
|
In The Light Of Fire
|
In the MInd of an NPC
|
In the modern world with a game system!!! Reworking!!!
|
In the Name of God
|
In The Name Of Hope: To Become A God
|
In the Name of the Unholy Spirit
|
In the Naruto world (1)
|
In the Shadow of Heaven
|
In the shadows
|
In the Sorcerer's Service
|
In The Spiral: Connected Stories and Fragments from the Virtual Future
|
In The Tall Grass
|
In The Tyrant's Embrace
|
In the Wake
|
In this Dangerous World
|
In This Supernatural World Of Mine
|
In This World
|
In Umbra Hasta
|
In-game Item Storekeeper
|
Inada
|
Inalienable Rights: The After-Hours Molar Message
|
Inalienable Rights: The Notorious Necktie Negotiation
|
Inara
|
Incandescents
|
Incanto Anima
|
Incarnation
|
Incarnation : Another Dimension
|
Incarnation of Ice and Fire
|
Incarnation Of The One
|
Inception of Cultivation
|
Incomparable - (Unparalleled)
|
Incompatible Universe Merge
|
Incompetent Second Son
|
Incomplete
|
Incrementum
|
Incubus
|
Incursions
|
Indebted
|
Indefinite
|
Indigo
|
Indisposable Trash
|
Indistinct Instinct
|
Indomitable Marvel
|
Industrialising Dungeon: The Crimson Forges
|
Inertia
|
Inexorable Chaos
|
Infamous
|
INFAMOUS: Heroes of Villainy
|
Infarite
|
Infected Life {ON HOLD}
|
Infernal Bones: Book 2 in the Elemental Dungeon Series
|
Infernal Gems: Diamond
|
Inferno
|
Inferno of Ice
|
Infestation
|
Infested
|
Infigeas Online
|
Infinite energy in the distortion world
|
Infinite Frontier
|
Infinite Gameplay
|
Infinite Hiatus
|
Infinite Hiatus (completed)
|
Infinite Horizon
|
Infinite Horizons
|
Infinite Legend
|
Infinite Levels
|
Infinite Lifetimes
|
Infinite Martial Way
|
Infinite Possibility
|
Infinite Quest: The Crazy Ice Wizard
|
Infinite Realm: Monsters & Legends
|
Infinite Realms (Working title)
|
Infinite Swordsman and His Cafe
|
Infinite Thera
|
Infinite Trigger: Wandering Soul
|
Infinite Wishes
|
Infinite: Monster
|
Infinity
|
Infinity - Aria's Odyssey
|
Infinity Arcana
|
Infinity Hero
|
Infinity Loop
|
Infinity Online
|
Infinity Start
|
Infinity Summoner ~ Summoner Of All
|
Infinity Tomes - Legacy of the Ancients
|
Infinity/10
|
Info on Andar's Worlds
|
Info on {The Sphere}
|
Infracto Animo
|
Ingame
|
Ingame 2 Homeland
|
Inglorious Bastard
|
Inhappening
|
Inheritance
|
Inheritance Of A Hobo
|
Inheritor of the two dragons
|
Inheritors
|
Inheritors (DEFUNCT)
|
Inheritors of Eschaton
|
Inhuman
|
Initializing the Code System
|
Ink Serpent
|
Ink Stained Eyes
|
Inked & Pierced (LGBT)
|
Inkway to Albreton
|
Inner Light
|
Inner-Self
|
Innocence
|
Innocence: Exiled Prince
|
Inquilbus
|
Inquilbus **Indefinite Hiatus**
|
Inquisitor
|
Inquisitor [HIATUS]
|
Inquity Blaze
|
Insane Familiars And How To Deal With Them in Game and Real Life
|
INSANE: Humans and Demons
|
Insanely Lucky
|
Insania Online
|
Insanity Online! The Forging of A TRUE NORD
|
Insanity Paradox
|
Insatiable Hunger
|
Insect Dungeon Vs The World
|
Insect Dungeon vs The World. (On Hiatus!)
|
Insectasaur
|
Insectum Chronica
|
Insert Coin To Continue
|
Inside Metsys
|
Inside my Mind
|
Inside Us All are Seraphs
|
Insignia's Story
|
Insomnia's Embrace
|
Inspector of God
|
Instant Practice
|
Instant Supreme God
|
Instinct
|
Instinct Unlimited
|
Instruments of Fate
|
Insurmountable
|
Integration
|
Integrity and Solace: Divine Intervention
|
Intellectum [RealRPG series] Book 1
|
Inter Caelum et Terram
|
Inter-dimensional House Travel
|
Interactive Dungeon
|
Interactive Evolution
|
Interactive tribe
|
Intercessor
|
Interdimensional Garbage Merchant
|
Interdimensional Traveler
|
Intergalactic Convicts
|
Interlude
|
Interstellar raiders: A collection of short stories
|
Interstellar Warlock
|
Interstellar Warlock 1: Emancipation
|
Interstellar World Struggle TV
|
Intertwined World Domination!
|
Intervention
|
Interverse
|
Interview With the Hattoris
|
Interweaved Destiny
|
Interworld
|
Interworld Network: The Time Master by Dmitry Bilik
|
Into a Fantasy
|
Into a Strange World
|
Into Nothing
|
Into the Abyss
|
Into the Black
|
Into the Everwood
|
Into the Hulk
|
Into the Inferno
|
Into The Light
|
Into the Maelstrom
|
Into the one-piece world
|
Into the Portal: The Expedition in Centauri Planet
|
Into the rainforest
|
Into the Rift: Akali
|
Into the Secret (name still needed)
|
Into the Secret of Tirlus
|
Into the Storm
|
Into the Sun
|
Into the Trenches
|
Into The Valley Of Gods
|
Into The Wasteland
|
Into the world of Hero Academy
|
Into What Is Impossible [Special Forces In Another World]
|
Intrepid
|
Intricate Soul
|
Intrinsics
|
Invader Zim >> Not Just a Defect <<
|
Invasion
|
Invasion - A Nanomachine Magical World LitRPG Adventure
|
Invasion by Fire and Thunder
|
Invasion of the Dust Mice
|
Invent, Transform, Create and Destroy
|
Inverse Summoning
|
Inverted (Isekai)
|
Inverted: A Dark Isekai Fantasy Novel
|
Invictus
|
Invictus: Memoirs of an otherworlder on a mission
|
Invijible Panda
|
Invincible
|
Invincible all eons
|
Invincible Canadian Futa Goddess Cultivator
|
Invincible Canadian Hermaphrodite Goddess Cultivator
|
Invincible Canadian Hermaphrodite Goddess Cultivator.
|
Invincible Canadian Hermaphrodite Goddess Cultivator: Redux.
|
Invincible in other world
|
Invincible War God
|
Invincible wizard at Fairy Tail
|
InVirs
|
Invisible Werewolf Dracula meets Vampire Mummy Frankenstein
|
Invoker
|
Iona Online
|
IQ 100+ Samoyed
|
Ira's Faithful
|
Iraslyn
|
Iris
|
Irminsul - [participant in the Royal Road Writathon challenge]
|
Irobu's Odyssey of Deceit
|
Iron Blood Overdrive (Hiatus)
|
Iron Engine
|
Iron Saga - A Military science fiction adventure
|
Ironclad
|
Ironclad: Another world conquest
|
Ironclad: Another world conquest with unbeatable technology
|
Irrationality
|
Irregular
|
Irregular (Rewritten)
|
Irregular Awakening
|
Irregular Elementalist
|
Irregular Entity
|
Irregular Leveling
|
Irregular's Rebellion
|
Irresponsible Former God of War Renox
|
Iruedim
|
Is Heaven Supposed To Be Like This?! -Mature
|
Is it Possible to Kill a Hero?
|
Is it Really Ok for a Dungeon Master to Manage a Dungeon?
|
Is It Really That Hard To Become A God
|
Is it Reincarnation if I'm Still Dead?
|
Is It Wrong For A Spiritron Hacker To Pick Up Girls In A Dungeon?
|
Is It Wrong To Be A Mutant?
|
Is It Wrong to be a Vampire in a Dungeon?
|
Is It Wrong to Try to Pick Up Girls When You're Disguising as a Girl?
|
Is that a T-Rex outside my cave?
|
Is that a T-Rex outside my cave? (On Hiatus)
|
Is That A Wisp?
|
Is This Really Another World?
|
Is this really luck?
|
Is This The End?
|
Is your Mama and Llama
|
Isekai - If I was Born in Another World
|
Isekai Assassin
|
Isekai Avenger
|
Isekai Battle Royale
|
Isekai Delivery Service
|
Isekai Dudes On The Run
|
Isekai Gundam
|
Isekai Gundam (Dropped)
|
Isekai Gundam (Reboot)
|
Isekai kami desu ka? -- (God of another world is it?)
|
Isekai Mafia: Founding a Crime Organization in Another World
|
Isekai Mafia: Founding a Criminal Organization in Another World
|
Isekai Magus (A LITRPG Light Novel)
|
Isekai Reporter
|
Isekai series: Peaceful daily life of Orphanage manager
|
Isekai Speedrun
|
Isekai Strategy Game
|
Isekai Survival
|
Isekai Tales
|
Isekai Toaster - Toasting Bread in Another World
|
Isekai trash story
|
Isekai Warfare
|
Isekai Winner: Super Sweepstakes!
|
Isekai'd as a Level 999 God King but my Fate was changed to a Shadow Girl???
|
Ishbula-na' (I've joined the family of the lord of the 7th ring of the Abyss, help!)
|
Ishtar, the overabundantly fertile goddess
|
Island
|
Island Of Gods
|
Isolated Dungeon: Breaking The Chains Of Fate
|
Isolated Together
|
Issekai Mockery
|
It seems I reincarnated into that world, time to avoid the death flags!
|
It Spreads
|
It Starts With Chapter One
|
It That Laments
|
It Was All Just A Mask [A Dramione Story]
|
It wasn't my fate
|
It will end badly
|
It's a Gamers world after all!
|
It's a Reincarnation of the Reincarnator
|
It's a Reincarnation of the Reincarnator (Book I)
|
It's An Isekai Story, I Think?
|
It's cause I'm a genius
|
It's not a game
|
It'S Not About Destiny
|
It's Not Easy Making Money in the Apocalypse
|
It's not Paranoia if you're Right!; A Talltale of Nervous Wreck become a Duke in Other World
|
It's Only Another End of the World
|
It's raining goblins !? [Dropped]
|
It's the Healer's Life for Me
|
It's the Healslut's Life for Me
|
Itas Adventure
|
Iterum Nata
|
Ithaca
|
Ithalon: Galaxy Wars
|
Ithalon: The Glass Cannon
|
Ithalon: The Xenos' Files
|
Ithavoll Saga
|
Ito Ai: A New Dawn
|
Its an apocalypse?
|
Its Not So Bad To Wake Up In A Goblin Dungeon
|
Ivan-The Terrible
|
Ivellee Ivelleh
|
Iverson's Pillar
|
Ivory Crystal
|
Izar
|
Izgaea Tales
|
Izumi Hayato with System
|
I´m the Dog of a young Mageknight
|
J`nk: Refuse Refuge
|
Jack
|
Jack 21
|
Jack and Diane
|
Jack at World of Syntaria
|
Jack Mercury: Battle Academy
|
Jack of the Devil's death forged body
|
Jack's Adventure
|
Jack's Journey
|
Jack's Unlikely Adventures
|
Jack, The Inter-Galactic Wizard
|
Jack-of-All-Mages
|
Jacob WillBreaker
|
Jade Fire
|
Jade Fire (Hiatus)
|
Jade Fire (Wuxia)
|
Jade General
|
Jade Immortal
|
Jadepunk
|
Jaeger Saga
|
Jaflov
|
Jager: The death Angel
|
Jake and the Dynamo
|
James Foremans Star Jump
|
James Hunter
|
James of Galendar
|
Jane Doe Chronicles - The Case of the missing Imaginary Friend
|
Jank
|
January City (Project Lunation Book 2)
|
Jasmine
|
Jaune, The Strong
|
Jayke Cipher
|
Jayson Agonistes: Breaking Hell !
|
Jellyfish
|
Jeremy's Guide on How to Survive a Zombie Apocalypse
|
Jewel Story
|
Jeweler
|
Jezoi
|
Jigoku 101 no dasshutsu hōhō.(How to escape hell 101)
|
Jiharu: A Story of The Hunt
|
Jim's World
|
Jimoel the Great and Powerful
|
Jin
|
Jin The Talentless
|
Jinsei no Hineri
|
Jinsei no Hogo
|
Jintetsu
|
Jirandai
|
Job Arseoth - A Choose Your own Adventure
|
Job Arseoth - A CYoA Adventure
|
Job Change
|
Jobless Knight
|
Jobs for an Occult Handyman
|
Joe & Jess: Life inside a PC Game
|
Joe in medieval fantasy world
|
Joe– the chimpanzee cultivator
|
Joh-El, a Kryptonian in the Marvel World.
|
John
|
John Doe: A Nobody in Space.
|
John Smith
|
John the Average Knight: Marvellously Mundane
|
Johnny's Bizarre Fidget Spinner
|
Joie de Vivre
|
JoJo na Kimyō na Bōken: New Dawn
|
Jojo's Bizarre Adventure: Kars' comeback
|
JoJo's Bizarre Adventure: Run the Jewels
|
Joker's Potpourri
|
Joker's way of life
|
Jokes On You
|
Jolly Cooperation
|
Jolt
|
Jona R. Torres and The Sea Empire of Navarren
|
Jonah Now Jasper
|
Jordan Leoren – A Tale From The Wizarding World
|
Jormugandr's calamity
|
Jormungandr's calamity
|
Joruney To The Starry Sky
|
Jotuun
|
Journal of a Falcon
|
Journal of poetry
|
Journal Teleport Science Something
|
Journals of Cultivation
|
Journey
|
Journey for Destiny: One Piece
|
Journey In A New World
|
Journey into My New Life
|
Journey of 365 Days
|
Journey of 365 Days (((Kind of Completed)))
|
Journey Of A Creator
|
Journey of a God [LitRPG]
|
Journey of a God [LitRPG] [Haitus]
|
Journey Of A Hawk
|
Journey of a Mage
|
Journey of a Skeleton (undergoing rewrite on different account)
|
Journey Of A Stoner
|
Journey Of Destruction
|
Journey of Key (Updated)
|
Journey of my Core
|
Journey of Robotics
|
Journey of the Black Rose
|
Journey of the cheerful assasin
|
Journey of the New World
|
Journey of the Time Mage
|
Journey Of The Unrivaled Mage
|
Journey Of The Unrivalled Mage
|
Journey of Worlds : Auto System
|
Journey Through the Realms
|
Journey Through the Underdark - Eric EarthScorn Book 1
|
Journey through the Worlds
|
Journey to Amoraketh
|
Journey to Boundless Infinity
|
Journey to Elvander
|
Journey to Power
|
Journey to Raise a Dodge-Debuff Scarecrow
|
Journey To The Hell's End
|
Journey to the Underdark - Eric EarthScorn Book 1
|
Journey West 5000
|
Journey: Kai Yuuki
|
Journey: Rayder White.
|
Journeying Home
|
Journeyman
|
Journeys in the Fairworld: The Brigand of Potham (Complete)
|
Journeys in the Fairworld: The Gatekeeper
|
Jovan's Gaze
|
Joyde's Yellow Book - Volume 2
|
Judas Valiant: Chorus of the Machine Giants
|
Judging The Creation
|
Jumper
|
Jumpspark
|
June
|
Junkland
|
Junkyard Magician
|
Jupiter's Rising
|
Jurassic Island
|
Juryokine
|
Juryokine: Exile of Heroes
|
Just a Bystander
|
Just a garbage fanfic
|
Just a Guy in Space
|
Just a passing goddess, don't mind me.
|
Just a Pawn
|
Just a place to practise some edits, dont come here.
|
Just a random guy surviving Apocalypse litRPG
|
Just a random Zodiac Book in the Internet
|
Just a Rock[DROPPED]
|
Just a Simple Guy
|
Just A Simple Heist
|
Just a Teacher
|
Just A VRMMO Story
|
Just a zombie trying to survive
|
Just an average man!
|
Just An Outlier
|
Just Another Dungeon
|
Just Another Gacha System In Another World
|
Just Another Isekai
|
Just Another Isekai Story
|
Just another random summoning story
|
Just another RPG story
|
Just Bear it
|
Just Because Goblins are Level 1 Mobs, Doesn't Mean I Can't Explore the World!
|
Just Call me Yumi
|
Just Deserts
|
Just Don't Shoot the Quartermaster
|
Just For Fun
|
Just let me be a cannon fodder
|
Just Luck
|
Just one more level
|
Just Practicing
|
Just Practicing, Nothing To See Here
|
Just Useless Ideas for a Novel
|
Just your typical isekai story, or is it?
|
Just your usual summoning story
|
Justice in the One Piece World
|
Juvena
|
Juvenile Gladiators
|
K. O. Romance [ノ ッ ク ア ウ ト ロ マ ン ス]
|
K.I.N.G.
|
K.I.X
|
K.O.D. by Lirg123
|
Kael - Rise of the Blood Mage
|
Kael Cor:A Vampire's Awakening
|
Kaels Adventure
|
Kage in another world
|
Kage no Kami
|
Kage System
|
Kaiba's Prostitute
|
Kail's Life of Adventure [dropped]
|
Kain's Adventures
|
Kain, the Caveman
|
Kairos
|
Kairos & the Snowdrifts
|
Kairos & the Snowdrifts (Edited)
|
Kaiser de Jinrui
|
Kaiser Jager The Mutagen Hunter
|
Kalar's continent
|
Kaleidoscope
|
Kaleidoscope Book 1: Night has Fallen
|
Kaleidoscope End
|
Kalestra's Chosen **On Hiatus**
|
Kalethia
|
Kali Yuga
|
Kallix Rane
|
Kalos
|
Kalui
|
Kammi Kettu
|
Kana & Wing: Adventure Time on RoyalRoad
|
Kana Adventure
|
Kana death god
|
Kanai's Alchemical Rock
|
Kano's Necromantic Comedy
|
Kanojo no Jin
|
Karacatoa - Descent into Madness
|
Kariya Matou's Amalgam System
|
Karl
|
Karl Became an Axolotl and now he's in a Cave
|
Karma
|
Karma - The Game
|
Karma and Reincarnation
|
Karma Online: Awakening
|
Karma's curse; the demon lord of wrath
|
Karmic System
|
Karn
|
Katalepsis
|
Katarina the Witch Hunter
|
Katarina the Witch Hunter Book 1: Forest
|
Katarina The Witch Hunter Book 2: Aston
|
Katarina the Witch Hunter Book 3: Norn
|
Katarina the Witch Hunter Book 4: Ardeal Ordeal
|
Katarina the Witch Hunter Book 5: Darnell
|
Katarina the Witch Hunter Book 6: Fragments of Memory
|
Katarina the Witch Hunter Book 7: The Trial
|
Katarina the Witch Hunter Book 8: Sasaki the Witch Hunter
|
Katarina the Witch Hunter Book 9: The Saint
|
Katra
|
Kay=Zero
|
Kaylee's Journey
|
Kaz the infinite one
|
Kazama wa Onnaline
|
Kazan - The Hero No One Wanted
|
Keep Breathing
|
Keep it a Secret
|
Keeper
|
Keeper of Steeds
|
Keeper's World
|
Keepers of the Neeft
|
Keepers of Truth
|
Keeping it together
|
Keeping The Balance
|
Keflar - A Tale of an Unusual
|
Kelly
|
Kenosis of the Light Bearer
|
Kernstalion
|
Keter
|
Kether(Discontinued)
|
Key To Abusing The System
|
Keybash! GAME JAM!
|
Keys of the Endpoint
|
Khiral (A LitRPG Dungeon Adventure)
|
Kibo: The New Age of Cornith
|
Kichiro's Rampage
|
Kill 10 Rats
|
Kill Anna!
|
Kill the Caster
|
Kill the Joker: Survival Game
|
Kill Thy Gods!
|
KillDozer
|
Killed by a Japanese girl who fell crotch first on my face
|
Killed, Blessed, Reborn
|
Killing Amount
|
Killing Game
|
Killing X Intent
|
Killing Zombies Is Like A Game?!
|
Killstealer
|
KillStreak
|
Kind's Kiss
|
Kinda Dead: The Infernal Escapee
|
Kinda Real Online
|
Kindergarten goes LITRPG
|
Kindling Stars
|
Kindling Stars [Hiatus]
|
Kindred
|
Kindred Spirits
|
Kinetics
|
King
|
King - Hiatus
|
King Above All Others
|
King Cipher
|
King Eden Volume I
|
King Elementalist
|
King given from God
|
King Merc
|
King Of All Heavens
|
King of Another World
|
King Of Ant
|
King of Beasts
|
King of Cards - Superhero Litrpg
|
King of Glass
|
King of Hell
|
King of HOLLYWOOD (Revised)
|
King of Kings
|
King of Nobody
|
King of Ohst
|
King of Rogaria
|
King of Ruin
|
King Of Solace
|
King Of The Broken World
|
King of the Djinn Kingdom
|
King of the Fall: Origins
|
King Of The Farm
|
King of the Mountain
|
King of the Mountain, Again
|
King of the Multiverse
|
King Slime:From an Experiment to A Ruler, Backstory of a Boss
|
King system
|
King's Anarchy
|
King's Game : Zixx (The Monster)
|
King's Throne: Snow's Story
|
Kingdom
|
Kingdom Come
|
Kingdom Come: Archemi Online Chronicles Vol.3
|
Kingdom Creation System
|
Kingdom of Bees
|
Kingdom of death
|
Kingdom Of Demons
|
Kingdom of Earthos
|
Kingdom of Earthos (Book 1): The rise of an Eagle Rider.
|
Kingdom of Heartedvast
|
Kingdom of Ice
|
Kingdom of Mallic
|
Kingdom of Monsters: La Guardia
|
Kingdom of Ohst
|
Kingdom of Stars
|
Kingdom of the Dead
|
Kingdom of The GhostShepard
|
Kingdom of the Lich
|
Kingdom of the void
|
Kingdom of Tyr (Original)
|
Kingdom Quest
|
KINGDOM RISE, CASTING CROWNS: Your Way Called Peace
|
Kingdom Saga
|
Kingdom Shattered
|
Kingdom: To Rebuild the Lost
|
Kingdoms of Blood, Magic, and Apocalipse
|
Kingdoms Online
|
Kingdoms: The Game of Feuds and Feudalism
|
Kingmaker
|
Kings Game : The Origin Of A Monster
|
Kings Game : The Origin Of A Monster (Rewrite)
|
Kings Rising
|
Kings Rite
|
Kings: Immortals Amongst Us
|
Kings: The Fall
|
Kingun
|
Kira's second life
|
Kirby System
|
Kiri to Shinkirō | Mist and Mirage
|
Kisama No Ketsugo
|
Kismet - Volume 1 - A Song Written from Ash
|
Kismet Online: Root Alpha
|
Kiss of Tragedy
|
Kitsune
|
Kitsune in Rockford
|
KITTY KITTY - The future that never was
|
Kiturasha God
|
Kiyu's Box
|
Klaxon Overdrive Supernova
|
Klaxon Overdrive Superrnova
|
Knight & Condemned
|
Knight & Condemned (Completed)
|
Knight & Condemned (Completed)
|
Knight and Deserter
|
Knight and Smith
|
Knight City Nights
|
Knight Endeavor: The Crimson war
|
Knight Hunter
|
Knight of Corruption: The Seventh Swordsman
|
Knight of the Rising Sun
|
Knight of the Rising Sun Volume 1: The boy with the katana
|
Knight X Magic
|
Knight's Crusade: Regulus War
|
Knighted
|
Knightquest, Or The Tales Of A Lonely Knight: Interactive Gamelit/Litrpg
|
Knightquest: Interactive Gamelit/Litrpg
|
Knights Of The 6
|
Knights of the Faux God
|
Knights of the New Queen: Protector
|
Knights under a Green Sky.
|
Know Thy Enemy
|
Knowledge and Power
|
Known Danger System 42
|
Koala Online
|
Kobold
|
Kobold Expansion
|
Kobold Whisperer
|
Koins for Karon
|
KOJI FIGHTS THE WORLD! (The Bonder Legacy Book One)
|
Kolver
|
Kommentárok
|
Kool Kobold
|
Korrupted Angels
|
Kosmos
|
Kova + Rey
|
Kripp's Fate
|
Kudo's Magic Touch
|
Kueng Ning
|
Kuni no Senso
|
Kuni no Senso Volume 1: The Man from the Unkempt & Kunshu
|
Kunoichi Online
|
Kuro's Days
|
Kuromori-san's Table Tutorial!
|
Kurouzu 「クローズ」
|
KurtzPel:
|
Kusan The Death Lord
|
Kyle
|
Kyrio's Monster House
|
Kyrio's Monster House (Dropped)
|
L
|
L'Enfer et le Lapin
|
L.I.F.E. Begins
|
L.I.F.E. Begins (Book 1 - Complete)
|
L.I.F.E. Stories
|
La Familia mas poderosa del mundo de Harry Potter
|
La Fantoma
|
La puerta de Maltras
|
La Puerta de Maltras eng.
|
Labyrinth of Anchored Moments
|
Labyrinth of Gods
|
Labyrinth of Light: Stormbringer
|
Labyrinth Of Puppets
|
Labyrinthia's Maze
|
Labyrinthium
|
Lackluster Adventure of a Side Character
|
Lacraea: The Slow Journey To riches
|
Lacuna: A Nexus Troupe Novel
|
Lads of the Triangles
|
Lady Bunny
|
Lady Sunshine and the Drowning Games
|
Lagoon
|
Laim And The Garden
|
Lainzax
|
Lair
|
Laksil
|
Lamb of Misfortune
|
Lambs and Wolves
|
Lament of The Demiurge
|
Lament of the Determined
|
Lament of the Fallen
|
Lament of the Slave
|
Lamp of Gods- Tales of an Immortal
|
Lamplight
|
Lancelot Deep Impact
|
Lancelot Dungeon
|
Lances & Daggers
|
Lances & Daggers
|
Lances and Daggers
|
Land of Astria
|
Land of Athlora
|
Land of Chi: The Legacy Trial
|
Land Of Dragons
|
Land of Erden
|
Land of Ilragorn
|
Land of Irith
|
Land of the Dead Sun
|
Land Of Zhelerez
|
Land Warrior: Greyhounds
|
Landasy Reality: Demon's Rebellion
|
LandFall's legacy
|
Landfill Life
|
Lanuleta University: A World of Magical Science and Strange Connections
|
Laria - A LitRPG
|
Laruse
|
Larystaro
|
Lasershark of The Laserocean
|
Last Born of Kiedarth
|
Last Dance
|
Last Dream
|
Last Embers: A Loki Story
|
Last Feast
|
Last flames of the Old World.
|
Last Flight of the Raven
|
Last Game
|
Last Goodbye
|
Last Grace: The Apex of Another World
|
Last Grace: To the Apex of Another World
|
Last Hope
|
Last Howl
|
Last Man On Earth When There Is No Earth?
|
Last Man Tournament: Altair
|
Last of the 300
|
Last of the Mage-Kings
|
Last Ramas
|
Last Shadows of a Booming Sky
|
Last Son
|
Last Stand
|
Last Voice in the Darkness Series, Book 1 - Survivor
|
Last wish from Dead past ( on work title)
|
Last Year [of High School]
|
Late Night at Lund's
|
Late to the game
|
Laurels and Thorns
|
Laus Deo
|
Lavender Rose
|
Law of Creation
|
Law of Divine Gates
|
Law of Incongruity
|
Law of Shadows
|
Law of the Forest
|
Law of the Jungle
|
Lawless
|
Lawless Ink
|
Lawless World
|
Laws of Defiance
|
Laws of Fate
|
Laws Raine
|
Layers of Hell
|
Lazarus: Jove's Tale
|
Lazy Ash
|
Lazy Cat
|
Lazy Cultivation
|
Lazy Detective
|
Lazy Dragon Queen: Gaming in an Illogical World
|
Lazy Guy With Dimensional Group Chat
|
Lazy Man's End of the World
|
Ldk
|
League of Meruem
|
League Of The Void
|
Leagues Away From The Sun's Light
|
Leah, Reincarnated As a Dungeon Core!
|
Learn to Evolve
|
Learning to be a Bad Guy
|
Leave A Scar (Fullmetal Alchemist)
|
Leaves of Terranthir
|
Leaving Earth
|
Left Behind In Another World
|
Left In Sorrow
|
Left Over Necromancer
|
Left the World as Villager A. Came Back a Mecha Pilot.
|
Left Unspoken (Book One of the Betrayal Series)
|
Legacy
|
Legacy (vrmmo game)
|
Legacy - Book 01
|
Legacy of Ancients
|
Legacy of Darkness: Book 1 - Darkness Ascendant
|
Legacy of Darkness: Book 1 - Darkness Rising
|
Legacy of Ennea
|
Legacy of Kail
|
Legacy of Power
|
Legacy of Terra
|
Legacy of Terra: Forgotten
|
Legacy of the Ancient
|
Legacy Of The Blade
|
Legacy of the Damned
|
Legacy of the Demon Lord
|
Legacy of the forgotten
|
Legacy of the Forgotten Continent
|
Legacy Of The Prototypes
|
Legacy of the Resourceful Hero
|
Legacy of the Sea
|
Legacy of the spirit king, Spirit Dungeon God edition (Currently being rewritten / revamped)
|
Legacy of U.L.T.R.A
|
Legacy of U.L.T.R.A (dropped)
|
Legacy of U.L.T.R.A (hiatus)
|
Legacy Of Weapons
|
Legacy Online
|
Legacy Unbroken
|
Legacy: God's Inheritance
|
Legacy: Lord Alba
|
Legend
|
Legend Land: Tale of the Nameless God
|
Legend of Amnesiac Archer
|
Legend of Chase Marcus
|
Legend of Darkness
|
Legend of Eterna
|
Legend of I, Reaos Alzerin
|
Legend Of Kaiser
|
Legend of Legendary Summons!
|
Legend of Lunos [Dropped]
|
Legend of Magus Academus 1: The Pillars of Unity
|
Legend of Mammon
|
Legend of Rall Gregory
|
Legend of the Black Blade
|
Legend Of The Blacksmith King {Hiatus}
|
Legend of the Conqueror by CyberBeast
|
Legend of the Crystal Borne: Wielders of Lightning
|
Legend of the Devourer of Kings
|
Legend of The Divine Beasts
|
Legend of the Dragonborn
|
Legend of the Empyrean Blacksmith
|
Legend of the Evil Hero
|
Legend of the Five Knights 1- Rise of A Guardian Angel
|
Legend of the Five Knights 2- The Shadow of Justice
|
Legend of the Forsaken One
|
Legend of the Guild: Point Blank
|
Legend of the Gunslinger Mage
|
Legend of the Heavenly Monarch System
|
Legend of the immortal robot
|
Legend of the Infinity Blades
|
Legend of the Lost Star
|
Legend of the Lost Star [Book 3: The Last and the Lost]
|
Legend of the Lost Star [Book 4: The Unravelling World]
|
Legend of The Matriarch
|
Legend of The Monster Slayer
|
Legend of the Nameless Hero
|
Legend of the Perfect Emperor
|
Legend of the Phantom Hero
|
Legend of the Sage by Daedalus
|
Legend of the Seven
|
Legend of the Sixth Sage
|
Legend of the Sword God
|
Legend of the Sword Immortal
|
Legend of the Undead Sovereign
|
Legend of the Void
|
Legend of the Void Lord
|
Legend of the Void Walker
|
Legend of the wasteland
|
Legend of Truck-san
|
Legend of Yomi
|
Legend Tales: Fallen Hero
|
Legend to God Restart
|
Legend: The Rise Of The Black Phoenix
|
Legendarium
|
Legendarium Props
|
Legendary
|
Legendary Archers Series: Shattering Arrow
|
Legendary Archers Series: Shattering Arrow {Dropped}
|
Legendary Archers Series: Shattering Arrow {Long Hiatus}
|
Legendary Continent
|
Legendary Crafting System
|
Legendary Crafting System {Long Hiatus}
|
Legendary Dungeon Seed
|
Legendary Elemental Knight
|
Legendary Exile
|
Legendary Farmer
|
Legendary Puppeteer Master
|
Legendary Reincarnator
|
Legendary System
|
Legendary Twilight Farmer
|
Legendary Void Dungeon
|
Legendary Wife : Overpowered Songstress book 1
|
Legends
|
Legends of Adora, This Halfryta's Garden
|
Legends of Balance: Alaiah
|
Legends of Bitworld: A Misnomer's Tale
|
Legends of Dorthar: Kato's Tale
|
Legends of Etheria
|
Legends of Gods. Tale of Vjaira.
|
Legends of Lost Fallow: Age of Heroes
|
Legends of Pandorus I: Song of A Crimson Angel
|
Legends of Regalia book 1: Tyranny and Villainy
|
Legends of Tarthirious, A LitRPG, Book One of Kylia's Story
|
Legends of Tarthirious: Book Five of Kylia's Story
|
Legends of the 21st Century (Complete)
|
Legends of the 21st Century (dropped)
|
Legends of The Great Savanna - Complete Book 1, Ongoing Book 2
|
Legends of the Shadow Immortal
|
Legends of The War God
|
Legends of the Wesh: Lochley
|
Legends of The Worlds Gate
|
Legends Of Valkyries:Endless war on Middle Earth
|
Legends of Zyantra: Immortals
|
Legends Online
|
Legion
|
Legion, God of Monsters
|
Legionary (dropped)
|
Legionnaire
|
Lein Saviik
|
Lemme Smash! (Hiatus)
|
Lemondream
|
Lens: Allegiance
|
LEo
|
Leo The Lion
|
Leonel's Workshop
|
Leonora
|
Les Cents Royaumes d'Aldire [French]
|
Les Kerns de l'Oubli - tome 1 : L'Exil [FR]
|
Lesser Throne of Seventh Heaven
|
Let Me Make You a Star
|
Let the games of survival begin!
|
Let the hunt begin!
|
Let The World Burn in Ruins
|
Let there be fire
|
Let's Be Gods!
|
Let's Define Evil
|
Let's Explore The New World!
|
Let's Form a Party to Kill God
|
Let's Go Anywhere: The Journal of two Idiots
|
Let's Invade A Fantasy World!
|
Let's play a game
|
Let's Shine
|
Lethal Virtue
|
Leticia
|
Lets live safe and happy life
|
Letter B Above Hell
|
Letters from a Dying World
|
Letters From a Lost Bird
|
Letters From Beyond
|
Letters: Naruto's Rebirth and Redemption
|
Letting Go...
|
Level 99 Looter: Among The Ancients
|
Level Down
|
Level One Chef
|
Level One Commoner
|
Level Up
|
Level Up Hero!
|
Level Up Lord
|
Level up or Die: Masochist
|
Level Up!
|
Level: Zero
|
Leveling Immortal
|
Leveling up !
|
Leveling Up Is Better Than Reality
|
Leveling up the World
|
Levia Codex
|
Levis Magus
|
Levy's misfortunes
|
Lewd Slime Surpassing The Heavens With Yandere Waifu
|
Lewis
|
Lexson of Aerolite
|
Ley World-The Game
|
LFSA - Starting from the summoning
|
Li'Kyes the Scaled Hero [HIATUS]
|
Lia and Lara will seek the One Piece
|
Liar Liar
|
Liars Called
|
Liberi Fatali
|
Liberty in the Overlord Universe
|
Liberum Mundi
|
Library Magic
|
Library of Knowledge - A tale across worlds
|
Licentia - Child of the Abyss
|
Lich Dungeon
|
Lich in Hero's Realm
|
Lich. The Depressed Necromancer
|
Lichen Leech
|
Lied
|
Life - Break
|
LIFE - Root
|
Life and assumptions of Dread The Caveman
|
Life As A Dungeon Core
|
Life as a Game, Cool
|
Life as a mercenary (Inactive)
|
Life As a Servant
|
Life as a solo gamer
|
Life as an Alpha-Knight
|
Life as an Independent Space Hauler
|
Life as the World's Most Feared Monster!
|
Life Changing Status Screen
|
Life Hunter
|
Life in a changed world
|
Life in a Fantasy World
|
Life In A Galaxy Far, Far Away
|
Life in a Red World
|
Life in another world
|
Life in another world (On hold)
|
Life in another world with an Immunity System
|
Life in New World (LNW)
|
Life in Newerth
|
Life In Purgatory
|
Life in Thar'al
|
Life in the naruto world.
|
Life in the New World
|
Life in the North - An Apocalyptic LitRPG
|
Life Insignia - A Lit!TacticsRPG.
|
Life is Boring.
|
Life Is But A Game
|
Life is Feudal
|
Life Is Just A Game
|
Life is Just_____
|
Life is not a game: Ice
|
Life is too short, let's murder to make it longer!
|
Life is Wilde
|
Life Leak
|
Life Magic, An Elemental Fantasy
|
Life Merchant
|
Life of a Core
|
Life of a gloomy boy
|
Life of a Grimoire
|
Life of a Hairpin
|
Life of a Immortal
|
Life of a world tree druid
|
Life of an Irregular
|
Life of an Undead
|
Life of an Unusual Troll
|
Life of David
|
Life of Evil
|
Life of Numbers
|
Life of the dark god
|
Life Of The Vampire Girl
|
Life Of The Vampire Girl - [Dead]
|
Life on Jupiter Station
|
Life Reset
|
Life Restart: Team Deathmatch in Another World
|
Life Sentence
|
Life Spent
|
Life Story of the Silent Seven Swords
|
Life Sucks So Deal With It (LSSDI)
|
Life Symphony
|
Life With A Blue Screen
|
LIfe's a game
|
Life's Blood
|
Life's Exodus
|
Life, Death and Other Troubles
|
Life, the struggle for existence
|
Life: New Game +
|
Life::Uploaded
|
LifeCraft
|
Lifeline
|
Lifestones of Lebreima
|
Lifeward
|
Light and Darkness of the Dragon Blades
|
Light Cleric
|
Light is suppose to be weak
|
Light of Gemini
|
Light of Shadows (Dropped...)
|
Light of the Heavens
|
Light of the Moon
|
Light Of The Nine
|
Light Rays
|
Lightning Does Strike Twice
|
Lightning Heroic
|
Lightning Soul Emperor
|
Lightning Watt
|
Lightning's Apprentice
|
Lil ko's heart
|
Lil'dude and the Goth girl Elf
|
Lilac Moon
|
Lilia's Shadow (The Wastelands Book 1)
|
Lilies Over Roses, Spring Over Autumn
|
Lilith
|
LIlith's Firstborn
|
Lilith, the Demon
|
Lily Bouquet - A Girls Love Anthology
|
Lily Ex Machina [COMPLETED]
|
LimeLight: The Galaxy's Deadliest VR Gameshow
|
Limerence Somnium
|
Liminal Radiance
|
Liminal Radiance: Path Of Old Dreams
|
Limit Break
|
Limited Fears
|
Limited to Pampering in Marriage: Report to Captain, I'm Pregnant.
|
Limiter Off
|
Limitless
|
Limitless Adaptation
|
Limitless Lands
|
Limitless Lands Book 2, Conquest
|
Limitless Paradox System
|
Limits
|
Lineage I
|
Lingering Elements
|
Lings
|
Link
|
Linked
|
Lion's Heart
|
Lionheart
|
Lionheart - Chronicles of Two Worlds
|
Lionheart: Chronicles of Two Worlds
|
Liquid Magics
|
Lirgaid's Adventure
|
Lissana
|
Litmmorpg
|
LITRPG (Book II) - Mecc 12 : Cannon Fodder (Unedited)
|
LitRPG Apocalypse (Working Title)
|
Litrpg What A Fun Way For The World To End
|
LitRPG: Grand Age - Lord Of Bloodlines
|
Little Baron & Big General
|
Little Beirut
|
Little Devil
|
Little Fish Dreameths of the Sky
|
Little Fox
|
Little Fox Soaring to Heaven
|
Little Giant
|
Little karma game
|
Little Legs
|
Little master in a new world
|
Little presence and almost no shadow
|
Little Red: A fairy tale RPG
|
Little Thief Not anymore ~
|
Live by the Sword
|
Live Life Homunclus
|
Live So That You May Live
|
Lives Of The Immortals - Rise Of The Strongest Magician
|
Liveship
|
Living a Long Life as a Legend
|
Living a Regular Life with a Game System
|
Living as I please, As a loli Demon King
|
Living Free
|
Living Happily in Another World
|
Living in a Fantasy Sucks
|
Living In A Fantasy World
|
Living in a Game-Like World, is a Skill (Random Schedule)
|
Living in an Urban Fantasy
|
Living in another world in peace and harmony i think!!!??
|
Living in His Dreams
|
Living in His Dreams (Ongoing)
|
Living in my Own World!
|
Living in Paradise
|
Living in the Bones
|
Living in This World
|
Living Legend
|
Living Life as a Demon
|
Living Life As A Game: Through And Through
|
Living Life as a Plant in a Magical World, Quite Strange Right?
|
Living My Second Life My Way
|
Living Steel
|
Living the Fantasy
|
Living Weapons
|
Living With Job System On Earth
|
Living With Loba: A Yandere Story
|
Living With Magic
|
Lizardventures
|
LMF = Legendary Midnight Farmer
|
Load State 01
|
Load Them Up!
|
Loaded Dice
|
Loading...
|
Local Heroes
|
Locking Horns, Breaking Teeth.
|
Locking Horns, Breaking Teeth. [Minotaur Paladin Rewrite.]
|
Log of a Slime Evolutionist
|
Logical Labyrinth
|
Lohikarmen: A tale of humans and dragons
|
Loiterous
|
Loki's Daughter, Tales of the Opal Dungeon
|
Loki: The Burden of the Throne
|
Loli Saga
|
Lolly
|
Lone Alpha.
|
Lone Survivor
|
Lone Wolf
|
Lone's Story Playground!
|
Lone: The Wanderer
|
Lone: The Wanderer [Rewrite]
|
Loneliness
|
Lonely Boy
|
Lonely Light (Complete)
|
Loner Boy
|
Loners' Aimeless Journey
|
Long Days, Long Nights
|
Long Experience
|
Long Island
|
Long Lost Traveler
|
Long Lost Traveler (Dropped)
|
Long Shadow
|
Long War
|
Long War [Old]
|
Longing
|
Longshot
|
Longshots
|
Looking Down From Olympus
|
Looking For Something Appropriate
|
Looking for the Sun
|
Looking through the window
|
Looks like I am a Cat-kin now?
|
Looks like I transmigrated into the body of a 'Saint'. What? I can do more!?
|
Loop - A time story
|
Loop of the destiny
|
Loose End
|
Loose Screws
|
Loot Mule
|
Lorctbvrorpgiraadhesgiaclswintrashwmdlsamygiadwimtdkagmactbapdsbihtaoatln?!
|
Lord Azul
|
Lord Dead
|
Lord Fear
|
Lord Grayson
|
Lord of all vamps
|
Lord of Dawn
|
Lord Of Dreams
|
Lord of Flukes
|
Lord of Glory
|
Lord Of Goblins
|
Lord Of Horrors
|
Lord Of Horrors [DISCONTINUED]
|
Lord of lust
|
Lord of Monster
|
Lord of Nightmares (dropped)
|
Lord of the Apocalypse
|
Lord of the Branchless Path
|
Lord Of The Flies
|
Lord Of The Flora
|
Lord of The Heavenly Villa
|
Lord of the Night
|
Lord of the Seas
|
Lord of the skies
|
Lord Of The Spells
|
Lord of the Supernatural
|
Lord of the Void
|
Lord of the White Flame
|
Lord of Undeath
|
Lord of War: Pandæmonium
|
Lord Protector
|
Lord Shadow
|
Lord Universe Creator
|
Lord Werdinger
|
Lordrian who was.
|
Lore - Gaming
|
Lore - Underworld
|
Lore and Legend - The Werewolf
|
Lore Unleashed
|
Lorian Ellins
|
Lorian Ellins [Dropped]
|
Los
|
Loser of Tarinath
|
Losian
|
Losing My Pride in that Vixen's World
|
Lost
|
Lost Archive
|
Lost Between the End and Now
|
Lost Blood
|
Lost Call
|
Lost Chapters of Eschatology: Vanguard
|
Lost Child
|
Lost Concord
|
Lost Crimson (book 1)
|
Lost Eden
|
Lost Emperor
|
Lost Girl
|
Lost Heroes: Atalanta
|
Lost Identity
|
Lost in a Dream
|
Lost in a Magical World
|
Lost In A Universal Sandbox.
|
Lost in Acleirea
|
Lost in an RPG World
|
Lost in Love
|
Lost in Morgent
|
Lost In Space
|
Lost in the Echo
|
Lost in the New World
|
Lost in the Past
|
Lost in the Wind
|
Lost in Time
|
Lost Leaves
|
Lost Lume: Project Rosaria
|
Lost Magic
|
Lost on the other Side
|
Lost One
|
Lost Origins: Ressurection
|
Lost Realm
|
Lost Shield
|
Lost Soul
|
Lost Soul Found Soul
|
Lost souls
|
Lost souls ( rewrite in progress.)
|
Lost Star
|
Lost to the Mist
|
Lost Tomb of the Necromancer
|
Lost Within Another World
|
Love & Witch Craft (A Web Light Novel )
|
Love Against the Karaoke Heavens
|
Love and Robots
|
Love at First Theft
|
Love Crafted
|
Love Crunch
|
Love Gone Wrong
|
Love Of Baybur [Participant in the Royal Road Writathon challenge]
|
Love Out Loud
|
Love Paradox
|
Love with Danger in the Purple: Being Beloved by the Hardhearted Avenger
|
Love you to the bone
|
Love's Vicissitudes: A Pursuit of Beloved Wife
|
Love,War and Astrovia
|
Love.exe
|
LoveGame
|
Lovelight
|
Lovely kNight: Our kiss will save the world?!
|
Lover's Life Line system
|
Loving Violet
|
Loving You
|
Low effort generic wish fulfillment story
|
Lucas Everton
|
Lucian
|
Lucid
|
Lucid Dream
|
Lucid dreamer
|
Lucid World
|
Lucifer Dark the summoned fallen angel
|
Lucinda the Shifter
|
Luck Based?
|
Luck is only an option
|
Luck Lockyer
|
Luckiest person in the world!
|
Lucks Requiem
|
Lucky
|
Lucky Dragon
|
Lucky Me!
|
Lucky Number Seven
|
Lucky Riot and the Mystic Dragon
|
Lucy Wickshire
|
Lucy Wickshire (warning: sexual content)
|
Lucy: I Was Reincarnated As The Queen of Vampires?!
|
Lume
|
Lumiere: The Astral Wanderer
|
Luminate Online
|
Lummox Flummox
|
Luna
|
Luna Daemonium
|
Luna: the Lunatic
|
Luna: What Happened Last Night?
|
Lunar Eclipse
|
Lunar One
|
Lunar's Dawn
|
Lune Levant
|
Lupa's Quest:
|
Lust uncontrolled!
|
Lust uncontrolled! (Complete)
|
Lust, like Vengeance, Demands Red
|
Luster
|
Lustfalter's Collection of Short Stories and Poetry
|
Lustrous Odyssey
|
Luxury Cafe Owner
|
Lv1 Creature
|
Lyaga
|
Lyca: Rise of Asura
|
Lyle
|
Lyra's Tale - a second chronicle of the Children of the Bear
|
Lyre: The Beginning
|
Lys
|
M O R T
|
M'Destiny
|
M-chan Wars: Rise and Fall of the Cat Tyrant
|
M-King
|
M.M.O (Massive Multiverse Online)
|
M.O.T.H.E.R. Reborn
|
Mabbo's Obscure Short Stories
|
Macabre Mim
|
Mace of Domination
|
Machina Core - Bastion Academy Book 1
|
Machinarium
|
Machine Supreme
|
Mackie Jade and the Dragon Duchess
|
Mad House
|
MAD MAGUS: A Tale of Almost Gods
|
Mad Moon
|
Mad Sci Soc
|
MAD Wendigo
|
Madi
|
Madly insane
|
Madly insane (dropped)
|
Madness
|
Madness with a touch of sanity
|
Maelstrom - New Generation
|
Maelstrom book 1 - A new beginning
|
Maelstrom Interlude - Defiance
|
Maestro Therapy
|
Mafia God!
|
Mage Blessed
|
Mage Hunter
|
Mage Slayer
|
Mage without mana
|
Mage x Magician
|
Mage's Rebirth
|
Magefall
|
Magenta
|
Mages of Temberlon: Growing Shadows
|
MAGES: Ascension : Hiatuss Infinitetum
|
Magi
|
Magia: Et Mosa Vero de Mundo (Magic: The World of Mesa)
|
Magic & Love
|
Magic Academy ( hiatus)
|
Magic and Martial War God
|
Magic and Mayhem
|
Magic and Mayhem (old)
|
Magic and Mercenaries. What can go wrong?
|
Magic and time
|
Magic Barbarian
|
Magic Beast Eaters
|
Magic Conquest / A Way to Magical World? or Not
|
Magic Continent Zero
|
Magic Fighter
|
Magic God of DxD
|
Magic Gunslinger
|
Magic is Magic
|
Magic is Overrated
|
Magic is Unusable, but at Least We Have a TP-82 Cosmonaut Survival Pistol
|
Magic Knight Legends: The Phoenix Empire Pilgrimage
|
Magic Marble in Space
|
Magic Monsters Money
|
Magic Not included
|
Magic of love (a GB yuri yandere story)
|
Magic of the Extinct
|
Magic Online
|
Magic Squared
|
Magic Swordsman, King Slayer.
|
Magic System: Becoming a Deity
|
Magic With You (BL)
|
Magic Within: A Thiefs End
|
Magic Zero
|
Magic, Monsters and Medieval Mayhem.
|
Magic, Monsters, And Other Things
|
Magic-Smithing
|
Magic;World
|
Magica Storia
|
Magical Adventure
|
Magical Beasts
|
Magical Cosmic
|
Magical Fraulein and the World Euphonics
|
Magical Girl Gang Wars
|
Magical Girl Selector
|
Magical Paradise
|
Magical Popcorn
|
Magical Puzzle
|
Magical Taboo
|
Magical Tournament: Rise Of The Black Swan
|
Magical Ume Knight
|
Magical World Domination
|
Magicat
|
Magicbound to a Snake Girl
|
Magician Endeavour
|
Magician's Code
|
Magician's Stigmata
|
Magician's Touch (Deadly Touch Book 3)
|
Magick Alive
|
Magick Online
|
Magicka Crest
|
Magidrasa
|
Magik
|
Magik Obelisk Rewrite
|
Magik Online
|
Magikarp Used Splash
|
Magikind
|
Magikind [Original]
|
Magikind [Rewrite]
|
Magitech Awakenings
|
Magitist
|
Magium
|
Magma Core ( A Mage's Journey)
|
Magnum Opus
|
Magnus
|
Magnus of Theta
|
Magune: Let The Magnet Rise
|
Magus Gravity
|
Magus In Another World
|
Magus of Soul
|
Magus Sunt Inferus
|
Mahou Shoujo Hologram Universe - A Grand Eye Tale
|
Mahou Shoujo Reincarnation
|
Mahouka x RoyalRoad By lolandylol
|
Mai Girl
|
Maiden of Fire
|
Maiden's Moon
|
Main Character in Author's World
|
Majai
|
Majeera Chronicles
|
Major Naird's Fantasy
|
Majority Rule
|
Make God Bleed!
|
Make It Twenty Three
|
Make Me the Protagonist, Please!
|
Make Me Wanna Die by Rock
|
Make No Mistakes
|
Make Your Mark and Other Stories
|
Maker Of A Universe
|
Making a difference
|
Making a Mark In The World
|
Making an Island
|
Making an Island (ReWrite)
|
Making magic, Forging fame.
|
Making my own Harem (dropped)
|
Making the best of a Betrayal
|
Making the best out of an Accident
|
Maksim's bluff
|
Mal
|
Malcolm and the Toe Goblins
|
Male Spy at an All-Girl's School
|
Maleficence
|
Malheur aux vaincus - Short stories
|
Malicious Arts
|
Malicious Arts: Astropolis Memorandum
|
Malicious, Magical, Malfoy
|
Malt the Manslayer
|
Malus Peior Pessimus
|
Mama Bear
|
Man From Earth
|
Man from the machine
|
Man from the Machine - The third Order
|
Man in Demon's Skin
|
Man In The Moon
|
Man of Earth
|
Man of the Hot Spring
|
Man Vs Edythe
|
Man With a Mace
|
Man With Many Faces
|
Mana
|
Mana : The Embodiment of Nature
|
Mana apocalypse book one becoming mages
|
Mana king
|
Mana Reincarnation
|
Mana Rule
|
Mana System - Hello, World!
|
Mana System - Hello, World! [REVISED]
|
Mana Tank Magus
|
Mana Unleashed Evolved
|
Mana Wall
|
Mana World - Convergence
|
Mana's Champion
|
Mana-Sight: The Ken Barnes Story
|
Manablood Mellie Isekai
|
ManaBorn
|
Manapocalypse
|
Mancers Grimoire
|
Mand'alor The Undying
|
Mandate of Heaven
|
Mandatory Isekai System
|
Manifest Fantasy
|
Manifest of Dao
|
Manifestations of faith: Return of the creators.
|
Manipulations
|
Mankind's Judgement
|
Manor on Server Seven
|
Manticore's Rise.
|
MANUS DEI (On hiatus. Pending rewrite)
|
Many many disoster
|
Maou : Summoning
|
Maou : Summoning [Hiatus]
|
Maou Decides to Write a Shoujo
|
Maou Shoujo Magical Chaos
|
Maou the Yuusha
|
Map of Mercury: The Buried City
|
Map to Hope
|
Maple Creek
|
Marae
|
Marakar
|
March City (Project Lunation Book 1)
|
Marcus Dungeon
|
Mare Nostrum
|
Margrave's Divinity
|
Margrave's Divinity (Rewrite)
|
Maria's Adventure
|
Mariah's Missing Sisters
|
Marionette of Chaos Magic: Evandaria
|
Marissa
|
Mark of a dragon
|
Mark of a Witch (Black Butler/Kuroshitsuji Fanfic)
|
Mark of the Triad
|
Marked (The Crystal Saga series book 2)
|
Marked Soul
|
Maroon Odyssey
|
Maroon Odyssey: Story of the survivors of a plane crash in a magical world
|
Marred Worlds [Discontinued]
|
Marriage And Monsters - An Eschatological Romance
|
Marrok's Loyalty
|
Marrow
|
Marrow Marionette
|
MarSide (Oneshot/Teaser)
|
Martial Academy (武灵学院)
|
Martial and Soul Cultivation: Yun Xe
|
Martial artist on a Mage World
|
Martial Crafter (Stopped)
|
Martial Family
|
Martial Flame
|
Martial God has Some Magic Troubles
|
Martial God with Naruto System in Another World
|
Martial Legend
|
Martial Legend [DROPPED]
|
Martial Life Online
|
Martial Magus
|
Martial Morpher
|
Martial necro
|
Martial path!
|
Martial Rebirth
|
Martial Resolve
|
Martial Road
|
Martial Spirit
|
Martial Spirit Ascendance!
|
Martial Striking Technique
|
Martial Void King
|
Martial World
|
Martial World & Summoned Hero
|
Martial World (Assasisin)
|
Martin's Life
|
Marvel Fanfic: Umbra
|
Marvel Gets Bizzare
|
Marvel Wild Fiction
|
Marvel's Phantom
|
Marvel+DC
|
Marvel: We Are Venom
|
Mask
|
Masked Magicians: Savior
|
Masking Tape
|
Masks: Greed
|
Masochism and psychopathy is my way of living
|
Masochist Berserker
|
Masquerade of Life
|
Masquerade of Souls
|
Master Alchemist
|
Master Bard
|
Master Dungeon Network
|
Master Exorcist
|
Master Healer, At Your Service!
|
Master Magician's Summoned Problems
|
Master Necromancer
|
Master Of All
|
Master of All trades
|
Master of All, Jack of None
|
Master of Ceremonies
|
Master of combat in a Different World
|
Master of divine blood
|
Master Of Dungeon
|
Master of Dungeons
|
Master Of Everything
|
Master Of Everything (Completed?)
|
Master of Experimental Magic
|
Master of Heaven
|
Master of Jade Cauldron
|
Master of Learning (Book 2)
|
Master of Learning (Color coded)
|
Master Of Music (may change)
|
Master Of The Dark Arts
|
Master of the Monster System
|
Master of the Multiverse
|
Master of the Void
|
Master of Weapons
|
Master Thief
|
Master Trainer Rei
|
Master's Doll
|
Masternever And The Flow Of Death
|
Masters
|
Masters of Shadow and Light
|
Mastery
|
Masthead
|
Mated To You
|
Materialize
|
Math God Plane - On Hiatus
|
Mathew The Mortal
|
Matt's Unfortunate New Life as a Woman
|
Matty's Misadventure
|
Max and Myx in Estrella
|
Maximus
|
Maxing Out From the Start!
|
May Aien Have Mercy
|
Mayaken
|
Maybe A Savior
|
Maybe it would have been a good idea not to wish for a harem?
|
Maybe it would have been a good idea not to wish for a harem? Completed
|
Mayfear
|
Mayhap Jak saga
|
Mayhem of Magic
|
Maze
|
MAZE- The Endless Quest
|
McShot's Crazy House: Many Stories in One Setting, It's an Anthology!
|
MCU inhumain Izel l'eternel
|
MCU Oneshots and Novellas
|
MCU'S Ghost
|
MDW's WebNovel Incubator
|
Me and My Army of Magical Beasts
|
Me and Myself (In Our Twin World Conquest Reverie)
|
Me Dragon
|
Me, My Car, and My Dreams Girl
|
Me, Myself, And I.
|
Me, Myself, And I. A journey with my Inner Dialogue
|
Me, The World and Everything About it
|
Me? Dragon
|
Me? Dragon?
|
Meakashi Collection
|
Meaning
|
Meant To Be Rivals
|
Meanwhile
|
Meanwhile at the Withershins Inn...
|
Meat
|
Meat Eaters
|
Mecchen House
|
Mech Domination
|
Mecha Stalin Massacre (An alternate-universe steampunk LitRPG)
|
Mechanica Fantasy Offline
|
Mechanical Heart
|
Mechanical Sect
|
Mechanization against magic
|
Mechanoid Gear : Survivor of Trezallion
|
Mechs? Mex? Mex's mechs!
|
Mechshift
|
Mecromancer Chronicles
|
Mecromancer Chronicles (Rough Draft)
|
Medic!~
|
Medical Wolf
|
Medieval Centuries Online
|
Medieval Terror
|
Mediocre in Another World
|
Meditation
|
Medium Meld (Naruto/Gamer, OC)
|
Medley of Fates Worse than Death
|
Medley of Fates Worst than Death
|
Medusa and the blind woman
|
Meet The Freak
|
Meeting myself
|
Mega Cringe: Dab
|
Mega fantasy
|
Megane Saga
|
Mekaboru
|
melancholy Fox
|
Melancholy of the 31st Demon King
|
Melas
|
Melas [Original]
|
Melas [Original] [Discontinued]
|
Melas [Rewrite]
|
Melee Warrior of Combat
|
Meliar
|
Mellie Mellie isekai
|
Mellinnium Myths
|
Melodious Requiem
|
Melvin The Necromancer
|
Memento Mori: Death Incarnate
|
Memoires of a Necromancer
|
Memoirs of a Monster Hunter
|
Memoirs Of A Withered Flower
|
Memoirs of an old traveler:First Rebirth
|
Memoirs of Karas Pesuto
|
Memoirs of the Broken
|
Memoriam Mine
|
Memories in Purgatory
|
Memories of a Trained Killer
|
Memories Of Alice
|
Memories of the Fall
|
Memory Seal
|
Memorybound
|
Mending Chaos
|
Menoitami
|
Menschenjaeger
|
Menstex
|
Mental Note
|
Mental World Online
|
Mercenary King
|
Merchanicide
|
Merchant
|
Merchant Contract
|
Merchant of the End
|
Merchanting Around The World
|
Mercury Rising
|
Mercury's Daughter
|
Meritocracy
|
Merlin: The man who forged his own destiny
|
Merticore
|
Messenger
|
Messiah: Soldier of the Orient
|
Meta-human: Brainstorm vs Omni
|
Metagame
|
Metahuman
|
Metahuman Maiden
|
Metal and Magic
|
Metal Elemental
|
Metal Lich
|
Metal Lich isekai to another world
|
Metal Samaritan (short story)
|
Metalbound
|
Metallic Blood [A Cyberpunk LitRPG]
|
Metallic Mind (working title)
|
Metamorph
|
Metamorphosis
|
METAMORPHOSIS - devouring Its way to immortality
|
Metaworld Chronicles
|
Metempsychosis
|
Method Of Loci
|
Methodical Mind
|
Metropolis
|
MHA: Villainous Conquest
|
Mhaieiyu - Arc 1: The Syndicate
|
Mhaieiyu - Arco 1: El Sindicato
|
Micah Ever After
|
Micchi Versus the New World
|
Michael Ammers: My OP leisure life
|
Michael Sawyer: Paranormal Investigator
|
Micro Evolution
|
Micro-Management: Survival Base
|
Midara: Paradox
|
Midara: Requiem
|
Midas Touch
|
Middle Management In Another World
|
Middle School Nostalgia
|
Midgard
|
Midnight Drive
|
Midnight Frost. A Winterwatcher Wings of Fire Fanfiction
|
Midnight in St. Petersburg
|
Midnight Moonlight
|
Midnight Moratorium
|
Midnight Raven (formerly known as: LazyTrash's Book-a-ma-bob)
|
Midnight Torches
|
Mifeln's Story Collection
|
Might of Alchemy
|
Mighty Sword King
|
Mikan Love
|
Mikayla the Dungeon?
|
Mike's Resting Place: Multiverse Pit Stop
|
Military Girl in the Zombie Apocalypse (Under Revision)
|
Milky Way (Wuxia/Si-Fi/Space)
|
Millennium Dungeon: War
|
Million Choices
|
Millstones of Destiny
|
Milo
|
Milton
|
Milton Merryweather and the Terrible, Horrible, No Good, Very Bad Adventure
|
Milton Merryweather and the Terrible, Horrible, No Good, Very Bad Day
|
Mimi O Saku
|
Mimicked
|
Mimicking The Gods [Hiatus]
|
Mimicking The Gods [Rewrite]
|
Mimicry New Life
|
Mind
|
Mind Ambition
|
Mind Linker
|
Mind Net
|
Mind of a Healer
|
Mind of the Minotaur: Tower Seed
|
Mind over Matter
|
Mind Reading Isn't Cheating
|
Mind Riot
|
Mind Stealer
|
Mind your Manors, please.
|
Mindcrawlers
|
Mindflaying Rebirth
|
Minding Others' Business
|
Mindshifter: The Mind War
|
Mindslaver
|
Mine
|
Mine from the Abyss
|
Minecraft power in a strange world
|
Minecraft: A New Beginning
|
Minecraft: The Story Begins!
|
Minecrafts Reality
|
Miner's Luck
|
Miner, miner?
|
Minglings
|
Minigun & Magic
|
Minor Mage
|
Minute Cultivator: Greatest Anomaly Teleported Ever (A.K.A: THE ULTIMATE GENIUS!!!!) o^T-T^o do you even lift bruh?
|
Miracle [Book 1]
|
Miracle Child: Slash The Gods [Dxd Universe] . (Mature Content)
|
Miracle Match Making App (MMMA)
|
Miraculous Spider Man
|
Mironov
|
Mirror Mirror
|
Mirror World: The Citadel by Alexey Osadchuk
|
Misadventure of the Goddess of Death
|
Misadventures in a Cultivation World!!
|
Misadventures Of a Broken Dungeon Core
|
Misadventures of a Rampaging Demon
|
Mischievous Dungeon
|
Misery and Hope
|
Misfits [Naruto/Gamer]
|
Misfits' Romance Society
|
Misfortune Night House
|
Mispaced Core
|
Miss Ophelia (A Draco Malfoy Love Story)
|
Missing Hattie
|
Mission Hearthwave
|
Missteps: A D&D Adventure
|
Mist
|
Mistaken Land: A Gamer's life in an another world
|
Mistakes Lead To Success
|
Mistakes Were Made: Short Stories That Shouldn't Be
|
Mistball Academy
|
Mistbound: Eternity
|
Mists of Ansehelm
|
Mists of Creation
|
Mists of Kel Doran: Season One - Dragon-Touched
|
Mists of Redemption
|
Mistwalker Xyn and the Cult of Eldritch Evil
|
Mistworld - Book 1 - Couch Potato Chaos
|
Mite
|
Mithra
|
Mixed Martial Cultivator
|
Mixing Blood
|
MLG Gaming
|
MLM Saga
|
MLP Equestria Girls - Lucky Chances
|
MMO Earth - The Culling
|
MMORPH Dungeon for me,(it's just a side project)
|
MNR Apocalypse [PAUSED]
|
Mob Boss of stage 1 (Haitus)
|
Mob without system in Naruto world
|
Modern Age Online
|
Modern Cultivator - The Sperm Who Cultivates
|
Modern Day Avatar
|
Modern day Dungeon
|
MODERN DAY OP-NESS
|
Modern Deity
|
Modern Magician
|
Modern Magician In Another World
|
Modern Magus (Working title)
|
Modern OP game system... With a glitch! (DROPPED)
|
Modern Superpower In Another World
|
Modern Warfare In The Medieval Age
|
Modern World Mages
|
Modern World Reformation
|
Moirae : Into the Adventure Land
|
Molten Core: The Ascension
|
Molting the Mortal Coil
|
Mona
|
Monarch of Heaven's Wrath.
|
Monarch of Heaven's Wrath. *Temporary Hiatus*
|
Monarch of the Darkness
|
Monarchy of the Ancients
|
Monarchy of the Ancients (Under Editing)
|
Monarchy of the Ancients [DROPPED, GO TO THE REWRITE]
|
Monday Monster Girls
|
Money Grubbing Demon Lord
|
Money is Everything
|
Money Making MMO
|
Money-Grabbing Daoist
|
Moniker's Mana
|
Monillas: A Human Garbage
|
Monition of Magic
|
Monkey's Tail
|
Monkeys are Amazing Creatures , Aren't They?
|
Monochrome Bleed
|
Monok's Bones: Discovery
|
Monolith
|
Monolith of Progress
|
Monroe
|
Monster
|
Monster and Cloud
|
Monster Apocalypse
|
Monster Brethren
|
Monster Buffet
|
Monster Calamity
|
Monster Core: Kill All Adventurers!
|
Monster Dungeon
|
Monster Eater: The Taste of Power
|
Monster Girl Collection [Web Version]
|
Monster Girl Collection: Mistrim Stories
|
Monster Girl Fusion.
|
Monster girls in the modern world
|
Monster Integration
|
Monster island
|
Monster Made
|
Monster Made - Turned into a Monster
|
Monster Me
|
Monster No. 1
|
Monster of Elements
|
Monster Queen
|
Monster Sage
|
Monster Soul Online
|
Monster Story
|
Monster Tamer
|
Monster Tamer in a World of Monster Hunters.
|
Monster Tamer In The Apocalypse
|
Monster Yurisume: My lesbian life with Monster Girls
|
Monster's Embrace
|
MonsterMancer
|
Monsters Cookbook
|
Monsters Dwell in Men
|
Monsters Dwell in Men - B2: Jehovah's Harmony
|
Monsters Engineering
|
Monsters of Terra: A Compendium
|
Monsters Paradise
|
Monstrous
|
Monstrous Intent
|
Monstrous Path
|
Montgomery and Carano
|
Moon Assassin
|
Moon Rabbit: Threaded Fate
|
Moon Shaped Dreams
|
Moon Song (On Hold)
|
Moonborn
|
Mooncaller
|
Moonlight
|
Moonlight - Book I: Dusk [Completed]
|
Moonlight Færie
|
Moonlight Prince and His Uncertainties! (HIATUS)
|
Moonlight Sword Sect
|
Moonlight wolf
|
Moonlight's Love
|
Moonlight: Crimson Moon
|
Moonlit Blood
|
Moonlit sky
|
Moonrise Valley
|
Moons of Orion
|
Moons' Shadow
|
Moonshot
|
Moral Complex
|
Morbid
|
More luck than I expected?!
|
More than Human? (Hiatus until late June/early July)
|
More:
|
Morgana
|
Morlock
|
Mormonism in Virtual Reality
|
Morph
|
Morph Genome
|
Morrigan and the House of Life
|
Mortal
|
Mortal Bodies, Timeless Soul
|
Mortal Energy
|
Mortal God
|
Mortal Minds
|
Mortal Skill God
|
Mortal's Game (Gods Online)
|
Mortalis Mortal
|
Mortasheen
|
Mortis Operandi
|
Mortis Operandi 1- New Hire
|
Mortis Operandi 2 - Hostile Takeover
|
Mortis Operandi 2- Terms and Conditions
|
mortuis -The necromancer
|
Moskau by G. Zotov
|
Mosquito Hivemind Hell-Bent on World Domination (or Annoyance)
|
Mosquito Lake
|
Mossharbor
|
Most Wanted
|
Moth Mound
|
Mother
|
Mother Nature
|
Mother of Learning
|
Mother of Monsters
|
Mother World
|
Mother's Basement Studios
|
Motherland
|
Mountain Shelter
|
Mountain's folly
|
Mountains folly
|
Mournebane: A world of swords, magic, monsters and dungeons
|
Mourners, Abednego, Persistence
|
Mourning Blades
|
Mourning Glory
|
Mourning Star
|
Movie Central
|
Moving Fortress In Another World
|
Moving into an SSS Ranked Dungeon?!
|
Moving Sloth
|
Mr Dungeon
|
Mr Mantis [Hiatus]
|
Mr. Familiar
|
Mr. Moon Rabbit, I'm Not Yours!
|
Mr. Vampire's Wife
|
Mr. X
|
Mr.Easy's adventure in One Piece
|
Ms Darcy's Apprentices
|
Mt. Tai in magic world.
|
Mu Xiyun: A Lonely Laugh Travelling The Lakes And Mountains
|
Mu: The Legend
|
Mud's Mission
|
Muddy Dreams
|
Muffins the Barbarian
|
Muhandae
|
Multi-carnation
|
Multiclass
|
Multiversal
|
Multiverse Apocalyse
|
Multiverse Leaper [Dropped]
|
Multiverse war: The worldhopping saga.
|
Multiverse with ____
|
Multiverse with Ten Servants Powers
|
Muna Miracle
|
Mundus Subcavus - or: "Caves are a geomancer's dream, but how do we get back out?"
|
Munivit Anima
|
Murario 2177
|
Murder Eternal
|
Murder Eternal: Fate Unknown (Book Two)
|
Murder Eternal: Prophecy Unfolding (Book One)
|
Murder Hobo Society
|
Murder of Crow
|
Murder Online
|
Murder the Mountains: A Dark Fantasy LitRPG
|
Murder, Mystery, and Monsters
|
Murderous Loves
|
Murim Login
|
Murmaider
|
Murphy's Law
|
Murphy´s Law
|
Mushroom Magi's adventure
|
Music by Cavelight
|
Music Masters
|
Music Masters: CD One
|
Music System
|
Musica
|
Musical Land (book 1)
|
Musings of a Hypocrite
|
Musings of the Secret Mortician
|
Must Protect The Saintess' Chastity! (BL)
|
Mutagenesis Phase One Dystopia
|
Mutant Beast Hunter
|
Mute
|
Mutt
|
Muzumi
|
Muzzle and Recoil: The Olympians [Temporarily Dropped]
|
My Ability
|
My Adorable Dryad
|
My adventures in Nope-World or How I came to Fear & Embrace the Horrors of 'Fantasy Australia'
|
My Annoying Aura Follows Me Into Another World
|
My another start in another world
|
My attack stat is negligible, so I can't help but rely on critical hits to succeed!
|
My attempt at writing a reincarnation Manhua
|
My Big Sister Is A Demon Lord | 我的姐姐是個大魔王
|
My Birthday Wish to be a Dungeon Master was Granted!
|
My Blind Familiar
|
My Bodyguard Can't Fight Girls!
|
My boring fantasy adventure
|
My Boring New Life!
|
My Bride is a Moon Rabbit
|
My Career is Useless in this World!!
|
My Cerberus Girlfriend
|
My cheat skill sucks
|
My Classmate is QiLin
|
My Collection of Riddle
|
My crazy little sister (arcadiablade)
|
MY CRAZY P. A (fated to love)
|
My Cursed Beloved
|
My daughter wants a Mommy
|
My Daughter's Crown
|
My Daughter's Crown [Complete]
|
My Delinquent
|
My Delinquent Sister Can'T Be My First Love...? | 我的不良的姐姐不可能是我的初戀...?
|
My Delirium Alcazar
|
My Demon Girl
|
My Demons
|
My Diary
|
My Dnd Characters
|
My Dragon World
|
My Dungeon
|
My Dungeon Life: Rise of the Slave Harem
|
My Enemy Saviour
|
My Everyday Life With A "Harem"
|
My Experence in the Starcraft Universe
|
My eyes can see
|
My Fantastic World Of Magic
|
My Fantasy
|
My Father is my Captain?!
|
My fiance is an alien
|
My Fiction
|
My first apocalypse
|
My First Party Member is a Slime
|
My first summoning
|
My Girlfriend is Thief
|
My Girlfriend, the Necromancer
|
My Girlfriend: Death
|
My Godly Body
|
My Good Friend Murphy
|
My Grudge is not ending!
|
My guild was transported to another world, but I'm just the Illusionist Enchanter
|
My Haiku Collection
|
My Happily Ever After
|
My Hermit Life
|
My Hero
|
My Hero Academia: Hero's Horizon
|
My Hero Academia: Lost
|
My Hero Academia: Pathway to the Top
|
My hero academia: Purple Tiger
|
My Hero Academia: Shattered
|
My Hero Academia: The Broken Candidate
|
My Hero Academia: The Broken Candidate (Major Reworks are coming)
|
My Hero Academia: The Broken Candidate (New story called 'Lost' is out.)
|
My Hero Academia: The Shattered Princess
|
MY Hero Academia: The Sixth Generation
|
My home is NOT your rest area!
|
My Hundredth Life
|
My insomnia is killing you
|
My Intergalactic Boyfriend
|
My job and adventure as a Technomancer
|
My Job is a Tailor
|
My Journey as the Fox head clan
|
My Lazy Days With A Fallen Angel
|
My Legend as an Evil Hero in Another World
|
My Legendary Adventure
|
My life after death
|
My Life as a Dragon's Assistant
|
My Life As A Fire Hero!
|
My life as a half-snake
|
My life as a human knight has begun
|
My life as a Hybrid
|
My life as a male harpy
|
My Life As A Superhero Slash Supervillain
|
My Life as an Teenaged Antagonist.
|
My life as Gohan
|
My Life In Another Worl
|
My life in another world - isekai
|
My Life in Dragon Ball
|
My life in the anime worlds.
|
My life in Valhalla.
|
My Life is a Series of Questionable Choices
|
My Life is Not a Manga, or maybe...
|
My life is ruled by my character stats
|
My Life Jumping Worlds. (DROPPED DUE TO NEW VERSION!)
|
My life story in different world
|
My Life With An Overlord And Anime System.
|
My Life,I'll lead it to full
|
My Life... With a Twist (will be on hold till summer break)
|
My Little Abomination
|
My little slave harem in another world!!
|
My Little Sunshine
|
My Love for the Demon Queen
|
My Love Story
|
My Luck Was Used as Payment... (ON HIATUS)
|
My Main Weapon .... Is A CLOAK?!?!
|
My Martial Spirit is System
|
My Modern world techniques against the cultivational world
|
My Monster Adventurer's Guild
|
My Monster Boy Harem
|
My Mythical Odyssey
|
My Name is RUIN (The Chronicles of Pavel Maveth - Book One)
|
My Naughty Princess Consort
|
My Necromancer is a Lich
|
My neighbor is a ditto
|
My never ending cycle of Life and Death
|
My New Arcane Life
|
My New Life as a Crow
|
My New Life In Another World
|
My New Life on the Otherworld
|
My New World
|
My Next Life's Choices Are To Be The Next Demon Queen Or Holy Saint
|
My Nightclub Landlady
|
My not so Peaceful Dungeon Life
|
My Obsession
|
My Only Lorelei
|
My Orange Glove
|
My Ordinary Life
|
My Own Dragon System In Anime Worlds
|
My own world
|
My Papa is my Damon King
|
My Papa is my Demon King
|
My parents are retired Superheroes
|
My Party Member is a Farmer - Literally
|
My Path of Justice
|
My Perfect Lady
|
My personal world
|
My Pick Up Artist System
|
My power is actually really OP you know
|
My Psychotic Ghost Girlfriend
|
My Psychotic Ghost Girlfriend 3M
|
My Psychotic Ghost Girlfriend [COMPLETED]
|
My Psychotic Ghost Girlfriend an Isekai Experiment Gone Wrong
|
My Psychotic Ghost Girlfriend an Isekai Experiment Gone Wrong 3M
|
My Real Empire
|
My real life Augmented Reality
|
My Reincarnated Life in a Fantasy World
|
My Reincarnation as a Chicken
|
My Reincarnation as a Fox Person, But I'm Also Harboring a Bunch of Godly Spirits
|
My Revenge: For a lack of a Harem
|
My Road to Become a Demon King
|
My Road To Glory
|
My Roommate is a Reptile?
|
My Sancutary is Purgatory
|
My Scary Wife Is So Cute
|
My School Is Transported Into Another World!
|
My second chance is as Dungeon Master?
|
My Second Life
|
My Second Life As A Father Of Two
|
My Second Life at Asura World
|
My Second Life is an Absurdist Power Fantasy?!
|
My Second Life: A Wishful Desire
|
My Second Time in this Terror-Stricken World
|
My Servant Is An Elf-Knight From Another World
|
My Servant Is Too Overpowered!
|
My sexy childhood friend returned and...
|
My SF Gun Romance
|
My Shapeshifting Life
|
My Shinobi Academia: Rising
|
My Short Stories
|
My Sister The Villainess
|
My Sister's An Alien
|
My Soul is Yours
|
My Star
|
My Stepmother's a Witch
|
My story Graveyard
|
My Story in the Otherworld
|
My Story, After Reincarnation
|
My strange friend
|
My Succubus System
|
My Succubus System (The Adventurer's Version)
|
My Supers Online
|
My Sword of Love is the Greatest Dao
|
My System Life
|
My System Only Has A Single Stat
|
My System Powers Up my Crew Not Me
|
My Thesis Project Online
|
My Thoughts Exactly
|
My Time to Shine
|
My Town's been Infiltrated by Monsters
|
My Trans-Dimensional, Overpowered Protagonist, Harem Comedy is Wrong, as Expected. (Oregairu/Danmachi)
|
My travel to a new game world
|
My Travels Through Another World: A Dragon's Tail
|
My Try at a Dungeon Story
|
My Tsundere Wife in a Different World (異世界で俺のツンデレ嫁さん)
|
My Usual Life With A Yandere
|
My Villainess Plans Were Ruined by my Brother!?
|
My weird version of fairytales
|
My Wish To Acquire 10 Wives
|
My Witch-Infested Life!
|
My world
|
My World Beyond the Closed Doors
|
My World To Live
|
My Youth love is a HAREM!!
|
My Yuri Adventure
|
Mycology
|
Mycology, A VRMMO Story
|
Myriad Domain
|
Myriad Huntress
|
Myriad Life
|
Myriad Paths
|
Myscreth
|
Mysteries of the Q Files: Rueben's Revelations
|
Mystery Dungeon
|
Mystery Dungeon: Save The World.
|
Mystery of the Dungeon
|
Mystfall Chronicles
|
Mystic Ink
|
Mystic ink: Mother's word.
|
Mystic Love Spells Trouble: Echo Encounter Volume 1
|
Mystic Nan
|
Mystic Pharaoh God
|
Mystic Reality
|
Mystic Swordsman
|
Mystic The Gathering
|
Mystic: Mark Of The Demon
|
Mystical Traveller
|
Myth
|
Myth Hunter
|
Myth Of Men
|
Myth of The World's Trees
|
Myth Online
|
Myth/Real
|
Myth: Legend
|
Mythalia : Dawn Of A New Era
|
Mythcleaver
|
Mythcraft: Heroes & Hellions
|
Mytheology
|
Mythical Conquest
|
Mythical Legends
|
Mythical Tyrant Ruler
|
Mythologia
|
Mythos Online
|
Mythran's Master Of All - Continued
|
Mythran's Master Of All - Continued (Completed!)
|
Mythril Mouse
|
Mythron Chronicles
|
Myths and Demons
|
Myths and Sigils
|
Myths, Monsters, and Legends (Fate/Percy Jackson Multicross)
|
NAAO: Serpent
|
NaClO Adventures
|
Nadia *Dropped*
|
Naga rising
|
Nagol: The Skeleton King
|
Nailed It
|
Nameless
|
Nameless Immortal
|
Nameless System V 1.00.008
|
Nameless: Ascent
|
Nandemonogatari: The Story of Something Else
|
Nanite Magician
|
Nanite World: A Sci-Fi LitRpg set in reality
|
Nanite: Infection (Book 1)
|
Nano Mage
|
Nanocultivation Chronicles: Trials of Lilijoy
|
Nanostar Short Stories
|
NanoTec: Flight to a Distant Star
|
Nanowielder
|
Nara of Nefarious
|
Narbeleth: The Sword of Light
|
Narcos India
|
Narice Arkline and the Seven Element
|
Narice Arkline and the Seventh Element
|
Naru Tower: Journey to Stronghold
|
Naru Tower: The Emerging Heroes
|
Naru Tower: Vinny Hallow
|
Naruto ? I should have chosen Pokemon
|
Naruto Fanon — Generations
|
Naruto Fans In Another World
|
Naruto Otsutsuki "The Immoral Legend"
|
Naruto Retsuden: Toru
|
Naruto The Reincarnated Narutard
|
Naruto World Isekai: A new Flower Blooms in a Different World
|
Naruto, The Mercenary of Fate.
|
Naruto: After the end.
|
Naruto: Blood Control in Naruto
|
Naruto: The Game of Life
|
Naruto: The Phoenix Wolf Jinchuriki
|
Naruto:Shadow
|
Narutoverse: Cultivation Style
|
Natalia
|
Natalia Nocte and the Arcadia Academy
|
Native Blood
|
NATIVE BLOOD (Series)
|
Native Blood: The Cursed Planet
|
Natural Alchemist
|
Natural Slave
|
Natural World
|
Nature Attribute
|
Nature is a Cruel Misstress
|
Nature Restart
|
Nature's Companion
|
Nature's Kingdom
|
Naulo's Corruption
|
Nav Station Algos
|
NCo (Title TBD)
|
Nebulanomicon
|
Nebulous Fate
|
Necara Online
|
NeckBeard
|
Necro-Merchant
|
Necrobyte
|
Necromacy - Dark World
|
Necromage
|
Necromancer
|
Necromancer by Halosty
|
Necromancer of Valor
|
Necromancer's Knight
|
Necromancer's Knight: a Light in Death
|
Necromancer'S Mountain
|
Necromancer's Pursuit
|
Necromancer's Resolve
|
Necromancer: The Melancholy of Macer
|
Necromancers Diary
|
Necromancy Domination
|
Necropolis
|
Necrotic
|
Necrotourists: The Undead Living the Life
|
Ned (The weakest species)
|
Need More Points!
|
Needle Guardian
|
Needs More Monsters
|
NEET No More
|
NEET of God
|
NEET Re:Quest High School
|
Nefarious Affairs
|
Nefarious Alike
|
Neiero: The Journey(Dropped)
|
Neimein
|
Neither Snow Nor Rain
|
Nekana, One in Billions, Lost.
|
Neko Loli with Saiyan Powers goes on a Adventure
|
Nekomancer: Just A Touch of Catgirls
|
Nello & Pastrache ~2nd~ :: (The Reincarnation Story of A Dog in Flanders in an LitRPG Transmigration)
|
Nelvinus
|
Nemidos: Tales of a Summoner
|
Nend Ardhon Chronicles
|
Neo
|
Neo - A LitRPG Adventure
|
Neo Cosmos
|
Neo-Virus #1.1 A Robin and A Crow
|
Neo-Virus: #1.1 A Hare and A Mountain Lion
|
Neo-Virus: #1.2 A Robin and A Crow
|
Neo-Virus: A Robin and A Crow
|
Neo:Arcanium
|
NeoGaea
|
Neomegalith
|
Neon
|
Neon Dark: Zero.Hero Book 1
|
Neon Hunters
|
NeoRealm - Staring back into the Future
|
Neos Online
|
Neoshinkei [Cancelled]
|
Nephilim: Beyond Good and Evil
|
Nephilim: Descent [Dropped]
|
Nephillim: Children of the Origin Project
|
Nercokitty!
|
Nerds in Dungeonia!
|
Nereid
|
Neriehem
|
Nero Zero
|
Nero, My Existence is Perfect
|
Nero, The Legendary Hunter
|
Nether Gods
|
Nether Lord Saga
|
Netherland : The Owl Eater's Legacy
|
Netherland: The Owl Eater's Legacy
|
Netherwyrm god
|
Netsuzou Trap
|
Network
|
Network Eye Online
|
Neuro-Plasticities (part 1: The Alt)
|
Neutral Chaos
|
Never After
|
Never Die Twice
|
Never Die Twice | HIATUS
|
Never Forgotten: The Dark Dragon Emperor
|
Never heard of that god? Well, wanna convert?
|
Never Split The Party
|
Never the Hero
|
Never-Ending Conflict: Nightfall City
|
Neverland
|
Nevermore
|
Neverstar
|
Nevertheless, A Fantasy World
|
New Age
|
New Age of Legends
|
New Age Online
|
New Australia (A LitRPG)
|
New beginning
|
New Beginning Online
|
New chance
|
New chance in fantasy
|
New Dawn
|
New Dawn Online
|
New Dawn- A Harry Potter Transmigration Fanfic
|
New Death
|
New Earth
|
NEW EARTH - A World of Chaos
|
New Earth System
|
New Earth- The Dungeon of Madness
|
New Eden
|
New Eden Royale (A LitRPG Adventure)
|
New Empire
|
New Epoch
|
New Era's Coming
|
New Escape
|
New Evolution 000
|
New existences
|
New Eyes
|
New Game (Reborn as a Reluctant Demon Lord, Book 1)
|
New Game +
|
New Game Minus
|
New Game Plus
|
New Game+
|
New God
|
New hope online
|
New hope online: to
|
New Horizons
|
New Kingdom Come
|
New Lands Online Book 1: Encounters A LitRPG Series
|
New Legends
|
New Legends: A New Chapter in an Old Book
|
New Life
|
New Life +
|
New Life + : Sins of Olarene
|
New life for an immortal soul
|
New Life in AOT(Attack On Titan) World
|
New Life in Labyrinth World
|
New Life of a Summoned Demoness
|
New Life Online
|
New Life Online: Battle Against The Strongest
|
New Life; New Hell
|
New META Swordsman
|
New Origins Online
|
New Path
|
New Player Confirmed
|
New Race
|
New Reality [HIATUS]
|
New Reality Online(legacy)
|
New Reality Online(legacy) ***DROPPED***
|
New Resident of 5th Apartment
|
New Return of the Condor Heroes 2006
|
New Roads
|
New Roads!
|
New Sorceress
|
New Soul
|
New Spartan
|
New to Magic
|
New To This
|
New Vista - The battle for 4th gen VR
|
New Vista - The battle for 4th gen VR [participant in the Royal Road Writathon challenge]
|
New world
|
New World +
|
New World Eden
|
New World God
|
New World Order
|
New World to Experience
|
New world, welcomes the overlord
|
New world, welcomes the overlord( hiatus)
|
New world: Survival [Draft]
|
New World: The Clan
|
New World: The path of an avenger
|
New World: The Tales of Everything that is Wonderful
|
New worlds
|
New York by Night- Vampire Chronicles Book 1
|
New: The Dark Inheritor
|
Nexitus: Neoteric Origins
|
Next Life: Awakening
|
Next Life: Reincarnated As an Elf
|
Next May
|
Next!
|
Nexus (Practice Writing)
|
Neziah, The Glyph Born Lich
|
Nice Guy Syndrome
|
Nice things
|
Nico, The Lord of Nothingness.
|
Night Game
|
Night Gaunt
|
Night Moves: An Urban Fantasy Adventure
|
Night Slaughter
|
Night Terror
|
Night Tremors
|
Night Visions
|
Nightborn
|
Nightengale
|
NightFall
|
Nighthawk
|
Nighthunter - Beyond the Black Gate
|
Nighthunter [hiatus]
|
Nightmare
|
Nightmare Infinity
|
Nightmare Online
|
Nightmare System
|
Nightmares
|
Nights of Sambria: And the Wish of Light
|
Nights With No Moon
|
Nights With No Moon (LGBTQ+)
|
Nightwalkers
|
Nigmus Online [2nd Draft Complete]
|
Nihil
|
Nihil - Volume 1
|
Nihon no Niko
|
Niko and the parade of shadows
|
Nill 'The Zero'
|
Nimrien
|
Nin the Seeker
|
Nina
|
Nine Artifacts, Elmyr's Last Errand
|
Nine Heads - A Hydra's Tale
|
Nine Paths Of Asura-Original Xianxia
|
Nine Realms VRMMORPG
|
Nine Rebirths [Title in Progress]
|
Nine Worlds Online [REV]
|
Nine-Tailed (MHA Fanfic)
|
Ningen no Tenshi
|
Ningen no Tenshin
|
Ninja
|
Ninja n' Fox (Spawn meets Naruto meets John Wick)
|
Ninth
|
Ninth World Lia's Struggle
|
Ninth World: Prima Natus Vampire
|
Nirv the Ether System
|
Nirvana
|
Nirvana Sect Master System
|
Nite Errant
|
No Absolution, An Antagonist LitRPG
|
No Angels
|
No Easy Mode
|
No Effort Power Fantasy
|
No Evil
|
No Face, No Life
|
No Fairy Fairy Tales
|
No Glory For You
|
No Heals!
|
No Level Up
|
No Life King
|
No limit
|
No Longer a Game
|
No Longer Alone
|
No Longer Human
|
No Matter What, I Will Get Back Home!
|
No Mercy
|
No Mischief Allowed !
|
No Moon
|
No More Respawns
|
No more TRY AGAIN button
|
No One Can Hear You Travel
|
No One's Hero
|
No Ordinary Hero
|
No Price Too Great
|
No Regrets
|
No Respawn
|
No Respawn [Patch 2.0]
|
No Rest for the Damned
|
No Strings Attached
|
No time like tomorrow
|
No Title Yet
|
No.
|
NOAH Online -Global Beta Test-
|
Noah's Ark
|
Noble
|
Noble Merc
|
Noble Sage
|
Noblesse Oblige: Ascendance
|
Nobody Except Us
|
Nobody Expected a Normal Story
|
Nobody Understands This Sarcastic Young Master
|
Nocturne
|
Nocturne (Version 2)
|
Nocturne of the Vampire
|
Nocturne: Rise of the Heavy Metal Saint (Vol. 1)
|
Noh'Doum
|
Noim
|
NOIM; Connected Worlds
|
Noir
|
Noir:
|
Noire
|
NOIS: A RWBY fanfiction
|
NoiZ Online
|
Noli Me Tank in a Mall
|
Nomad Dungeon
|
Noman's Land
|
Non-Existing Killers
|
Non-fiction
|
Noodle Knight
|
Nora and the Search for Friendship
|
Normal Guy
|
Normal in Parenthesis—The Old Will and the Dawn to All | Our World
|
Normalcy is for boring people!
|
Norman Faust
|
Norseman of the south
|
North Forest
|
Northern Cloud
|
Northern God
|
NoS: The Crypts in the Shadow (Hiatus)
|
NoS: The Crypts in the Shadow Vol 1 (Hiatus)
|
Nosoi
|
NOSOI (dropped)
|
Nostalgia
|
Nostalgic Gamer in a Cultivation World
|
Not a Genius's Survival Rules
|
Not A Hero
|
Not All Heroes
|
Not Alone
|
Not Another Fantasy Story!
|
Not Another Isekai RPG Story Alternate
|
Not another zombie apocalypse role playing game
|
Not as it seems
|
Not Getting Involved
|
Not Hurt by the Frost
|
Not Just Another Day
|
Not Many Get A Second Chance
|
Not My Wife
|
Not Quite an Author (Yet) [inactive]
|
Not Quite What You Meant (Short Story Collection)
|
Not Really Assassins
|
Not Reincarnation?
|
Not so Teen Wolf
|
Not the "Support" you were expecting
|
Not This Earth
|
Not your average Bird
|
Not Your Hero
|
Not Your Ordinary Day in Centralville
|
Note Red
|
Note the Night: Rise of Shadows
|
Notebook of possibilities
|
Nothing but bones
|
Nothing goes the way I expect!!!
|
Nothingness Erased
|
Nouvelle chance dans la fantaisie.
|
Nova
|
Nova in forgotten debts
|
NOVA in the marvel cinematic universe
|
Nova Roma
|
Nova Terra: Titan
|
Nova Vita.
|
Nova Vitam
|
Nova Vitam; A New Life in a 'New' World
|
Novak
|
Novam Vitam
|
Novarra
|
Novo
|
Novos Hitchhiker
|
Novos Hitchhiker (Defunct)
|
Novus Etá
|
Novus Lumen
|
Now I am Roselyn
|
Now That's Entertainment(a system apoc litrpg)
|
Nowhere Island University
|
Nowhere to Run
|
Nox
|
Npc
|
NPC (First Draft)
|
Npc 210M
|
NPC I want experience
|
NPC's Domination
|
NPCs are the strongest
|
Null un Voided
|
Numb
|
Numba Cruncha
|
Number One
|
Number One Commander
|
Number One Demon Under Heaven
|
Number One Under Heaven
|
Number One Under Heaven (Old Ver.)
|
Number One Under Heavens (Tian Xia Di Yi)
|
Number Two Under Heaven
|
Numbers Continually Going Upward
|
Nurarihyon System in Another World
|
Nuthouse
|
Nyaadventure: The Fluffiest of all story! [DROPPED T-T]
|
Nyanya N. Nya
|
NyaNyaNyaNyaNyaNyaNyaNya Meow Meow!
|
Nyix
|
Nyx - The Shadow Princess
|
Nyx: The Demon Princess
|
O : K
|
O.A.I.
|
Oak: A Tree's Quest
|
OAO - Olympian Anarchy Online
|
Oasis Core
|
Oath
|
Oaths of Ash
|
Oaths: A Tale of Two Brothers
|
Oaths: A Tale of Two Brothers (Being Edited)
|
Oaths: A Tale of Two Brothers (Hiatus)
|
Oban
|
Obey Me! x Reader - Oneshots? (Requests Open)
|
Obito's Mangekyō in Anime World
|
Oblivion Online
|
Oblivion Online (complete)
|
Obnoxiously Long Light Novel Title
|
Observation Calla Horizon
|
Observation of a Demon Tortoise
|
Observer 001's inter-multivursal log
|
Obsession x Mana
|
Obstacles
|
Occidendum
|
Occult Sorcerer
|
Occultivator
|
Ocean Graveyard
|
Ocean World of Chaos
|
Oceanic reincarnation: The adventure of a little Triop
|
Octopod
|
Odd Fate - What Other Side?
|
Odd Jobs for a Occult Handyman
|
Odd, How I Got Here
|
Odds
|
Ode to Freud
|
Odin, the fallen god
|
Odins Hall
|
Odyssey of Life
|
Odyssey of the Unrivalled
|
Of A Title That Is To Be Determined
|
Of AI and Orcs
|
Of Blood and Bones
|
Of Blood, Steel, and Lasers
|
Of Cats and Magic
|
Of Corporate Core Competency Plans, Capitalistic Synergized Growth Projections and Lethal Target Market Analyses.
|
Of Crowns and Rascals
|
Of Deities and Dimensions
|
Of Demons and Devils
|